257165

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 309599..310221 Replicon chromosome
Accession NZ_CP104107
Organism Pseudomonas mosselii strain PH4

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N0U38_RS01420 Protein ID WP_186712060.1
Coordinates 309599..309790 (+) Length 64 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N0U38_RS01425 Protein ID WP_260270751.1
Coordinates 309808..310221 (+) Length 138 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0U38_RS01400 (N0U38_01400) 304949..306007 + 1059 WP_260270749.1 putative 2-aminoethylphosphonate ABC transporter ATP-binding protein -
N0U38_RS01405 (N0U38_01405) 306009..307733 + 1725 WP_260270750.1 putative 2-aminoethylphosphonate ABC transporter permease subunit -
N0U38_RS01410 (N0U38_01410) 307764..308786 + 1023 WP_258800651.1 putative 2-aminoethylphosphonate ABC transporter substrate-binding protein -
N0U38_RS01415 (N0U38_01415) 308878..309423 + 546 WP_096048931.1 HD domain-containing protein -
N0U38_RS01420 (N0U38_01420) 309599..309790 + 192 WP_186712060.1 type II toxin-antitoxin system HicA family toxin Toxin
N0U38_RS01425 (N0U38_01425) 309808..310221 + 414 WP_260270751.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N0U38_RS01430 (N0U38_01430) 310333..310584 + 252 WP_096048929.1 helix-turn-helix domain-containing protein -
N0U38_RS01435 (N0U38_01435) 310584..311774 + 1191 WP_260271886.1 type II toxin-antitoxin system HipA family toxin -
N0U38_RS01440 (N0U38_01440) 311755..311964 - 210 WP_260270752.1 DUF3079 domain-containing protein -
N0U38_RS01445 (N0U38_01445) 312042..313187 - 1146 WP_028688483.1 copper-containing nitrite reductase -
N0U38_RS01455 (N0U38_01455) 313517..313723 - 207 WP_051555605.1 hypothetical protein -
N0U38_RS01460 (N0U38_01460) 313791..314171 - 381 WP_062572530.1 hypothetical protein -
N0U38_RS01465 (N0U38_01465) 314190..314396 - 207 WP_023629980.1 helix-turn-helix transcriptional regulator -
N0U38_RS01470 (N0U38_01470) 314406..314984 - 579 WP_096048926.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7019.12 Da        Isoelectric Point: 10.4613

>T257165 WP_186712060.1 NZ_CP104107:309599-309790 [Pseudomonas mosselii]
MNSREMISVIEADGWYLVRSKGSHHHFKHPEKAGLVTIPHPKKDLLPATAASILRQARIGYAS

Download         Length: 192 bp

Antitoxin


Download         Length: 138 a.a.        Molecular weight: 14936.06 Da        Isoelectric Point: 4.5801

>AT257165 WP_260270751.1 NZ_CP104107:309808-310221 [Pseudomonas mosselii]
MLFPIAILPGDDQHAWGVEVPDIPGCFSAGEDLDNAIAMAREAIEGHLEMLAQDQQEIPKASLVSVHAANPAYAGCTWAL
IDIDITRYLGKAEKLNITLPAYLLTRIDAYVQNHPEHKSRSGFLAEAALRILQGDCK

Download         Length: 414 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References