Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1379056..1379972 | Replicon | chromosome |
| Accession | NZ_CP104097 | ||
| Organism | Bacillus subtilis strain GL-4 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | N1207_RS07320 | Protein ID | WP_003244695.1 |
| Coordinates | 1379226..1379972 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | N1207_RS07315 | Protein ID | WP_003232646.1 |
| Coordinates | 1379056..1379226 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1207_RS07280 (1375919) | 1375919..1376248 | + | 330 | WP_041850928.1 | XkdW family protein | - |
| N1207_RS07285 (1376245) | 1376245..1376409 | + | 165 | WP_041850927.1 | XkdX family protein | - |
| N1207_RS07290 (1376453) | 1376453..1377292 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
| N1207_RS07295 (1377345) | 1377345..1377614 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| N1207_RS07300 (1377627) | 1377627..1377890 | + | 264 | WP_003232653.1 | phage holin | - |
| N1207_RS07305 (1377903) | 1377903..1378796 | + | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
| N1207_RS07310 (1378833) | 1378833..1378970 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| N1207_RS07315 (1379056) | 1379056..1379226 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| N1207_RS07320 (1379226) | 1379226..1379972 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| N1207_RS07325 (1380082) | 1380082..1381083 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| N1207_RS07330 (1381096) | 1381096..1381713 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| N1207_RS07335 (1381989) | 1381989..1383305 | - | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
| N1207_RS07340 (1383693) | 1383693..1384643 | + | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
| N1207_RS07345 (1384744) | 1384744..1384890 | + | 147 | WP_120363335.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1345183..1400472 | 55289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T257151 WP_003244695.1 NZ_CP104097:c1379972-1379226 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|