Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 509962..510598 | Replicon | chromosome |
| Accession | NZ_CP104097 | ||
| Organism | Bacillus subtilis strain GL-4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | N1207_RS02600 | Protein ID | WP_003156187.1 |
| Coordinates | 510248..510598 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | N1207_RS02595 | Protein ID | WP_003225183.1 |
| Coordinates | 509962..510243 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1207_RS02575 (506322) | 506322..506921 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
| N1207_RS02580 (507016) | 507016..507381 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
| N1207_RS02585 (507547) | 507547..508563 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
| N1207_RS02590 (508677) | 508677..509846 | + | 1170 | WP_015252766.1 | alanine racemase | - |
| N1207_RS02595 (509962) | 509962..510243 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| N1207_RS02600 (510248) | 510248..510598 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| N1207_RS02605 (510713) | 510713..511537 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| N1207_RS02610 (511542) | 511542..511907 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| N1207_RS02615 (511911) | 511911..512312 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
| N1207_RS02620 (512324) | 512324..513331 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| N1207_RS02625 (513393) | 513393..513722 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| N1207_RS02630 (513719) | 513719..514201 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| N1207_RS02635 (514167) | 514167..514955 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| N1207_RS02640 (514955) | 514955..515554 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T257150 WP_003156187.1 NZ_CP104097:510248-510598 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|