Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 2993..3594 | Replicon | plasmid pPF |
Accession | NZ_CP104090 | ||
Organism | Lactiplantibacillus plantarum strain VHProbi P06 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NYQ69_RS16450 | Protein ID | WP_265049708.1 |
Coordinates | 3250..3594 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A806J926 |
Locus tag | NYQ69_RS16445 | Protein ID | WP_001748109.1 |
Coordinates | 2993..3256 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYQ69_RS16440 (NYQ69_16440) | 2320..2907 | - | 588 | WP_041153703.1 | site-specific integrase | - |
NYQ69_RS16445 (NYQ69_16445) | 2993..3256 | + | 264 | WP_001748109.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NYQ69_RS16450 (NYQ69_16450) | 3250..3594 | + | 345 | WP_265049708.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NYQ69_RS16455 (NYQ69_16455) | 3713..5044 | - | 1332 | WP_265049709.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NYQ69_RS16460 (NYQ69_16460) | 5062..5193 | - | 132 | WP_015474697.1 | hypothetical protein | - |
NYQ69_RS16465 (NYQ69_16465) | 5206..5853 | - | 648 | WP_006844821.1 | DsbA family oxidoreductase | - |
NYQ69_RS16470 (NYQ69_16470) | 5872..6816 | - | 945 | WP_006844822.1 | thioredoxin-disulfide reductase | - |
NYQ69_RS16475 (NYQ69_16475) | 6907..7035 | - | 129 | Protein_8 | aspartate racemase | - |
NYQ69_RS16480 (NYQ69_16480) | 7035..7358 | - | 324 | WP_265049707.1 | thioredoxin family protein | - |
NYQ69_RS16485 (NYQ69_16485) | 7379..7693 | - | 315 | WP_015474701.1 | thioredoxin | - |
NYQ69_RS16490 (NYQ69_16490) | 7707..7988 | - | 282 | WP_008855846.1 | thioredoxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..14030 | 14030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12993.90 Da Isoelectric Point: 6.4748
>T257149 WP_265049708.1 NZ_CP104090:3250-3594 [Lactiplantibacillus plantarum]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLISSQTVCGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLISSQTVCGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|