Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 9386..9978 Replicon plasmid pHB42-4
Accession NZ_CP104081
Organism Escherichia coli strain HB42

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I9ZJC5
Locus tag N0M81_RS24340 Protein ID WP_000513532.1
Coordinates 9386..9634 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A1I9ZJ49
Locus tag N0M81_RS24345 Protein ID WP_000681609.1
Coordinates 9631..9978 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0M81_RS24305 (N0M81_24305) 4398..5063 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
N0M81_RS24310 (N0M81_24310) 5652..5981 + 330 WP_001542022.1 hypothetical protein -
N0M81_RS24315 (N0M81_24315) 6382..6897 + 516 WP_001025393.1 J domain-containing protein -
N0M81_RS24320 (N0M81_24320) 7001..7543 + 543 WP_001083904.1 hypothetical protein -
N0M81_RS24325 (N0M81_24325) 7540..7794 + 255 WP_001230709.1 hypothetical protein -
N0M81_RS24330 (N0M81_24330) 7791..8033 + 243 WP_000151456.1 hypothetical protein -
N0M81_RS24335 (N0M81_24335) 8604..8897 + 294 WP_000673428.1 hypothetical protein -
N0M81_RS24340 (N0M81_24340) 9386..9634 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin Toxin
N0M81_RS24345 (N0M81_24345) 9631..9978 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N0M81_RS24350 (N0M81_24350) 10066..10509 - 444 WP_023223351.1 hypothetical protein -
N0M81_RS24355 (N0M81_24355) 10750..11049 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
N0M81_RS24360 (N0M81_24360) 11309..11635 - 327 WP_000206697.1 hypothetical protein -
N0M81_RS24365 (N0M81_24365) 11637..11960 - 324 WP_223666488.1 hypothetical protein -
N0M81_RS24370 (N0M81_24370) 11937..12077 - 141 Protein_19 hypothetical protein -
N0M81_RS24375 (N0M81_24375) 12097..12804 - 708 WP_000108794.1 hypothetical protein -
N0M81_RS24380 (N0M81_24380) 12806..13558 - 753 WP_000797966.1 conjugal transfer protein TraL -
N0M81_RS24385 (N0M81_24385) 13576..13977 - 402 WP_021575837.1 hypothetical protein -
N0M81_RS24390 (N0M81_24390) 14345..14686 + 342 WP_000730722.1 plasmid mobilization relaxosome protein MobC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..60959 60959


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9378.03 Da        Isoelectric Point: 10.4800

>T257147 WP_000513532.1 NZ_CP104081:9386-9634 [Escherichia coli]
MGKADKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
VL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13206.97 Da        Isoelectric Point: 4.8313

>AT257147 WP_000681609.1 NZ_CP104081:9631-9978 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNILYGKLAFIRDLVTYEAETLADLEREFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSHHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I9ZJC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1I9ZJ49

References