Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 7540..8033 Replicon plasmid pHB42-4
Accession NZ_CP104081
Organism Escherichia coli strain HB42

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag N0M81_RS24325 Protein ID WP_001230709.1
Coordinates 7540..7794 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag N0M81_RS24330 Protein ID WP_000151456.1
Coordinates 7791..8033 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0M81_RS24285 (N0M81_24285) 3057..3209 + 153 Protein_2 FlmC family protein -
N0M81_RS24290 (N0M81_24290) 3157..3276 + 120 WP_229002406.1 Hok/Gef family protein -
N0M81_RS24295 (N0M81_24295) 3426..4022 + 597 WP_000125165.1 ProQ/FINO family protein -
N0M81_RS24300 (N0M81_24300) 4040..4324 - 285 WP_001162371.1 hypothetical protein -
N0M81_RS24305 (N0M81_24305) 4398..5063 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
N0M81_RS24310 (N0M81_24310) 5652..5981 + 330 WP_001542022.1 hypothetical protein -
N0M81_RS24315 (N0M81_24315) 6382..6897 + 516 WP_001025393.1 J domain-containing protein -
N0M81_RS24320 (N0M81_24320) 7001..7543 + 543 WP_001083904.1 hypothetical protein -
N0M81_RS24325 (N0M81_24325) 7540..7794 + 255 WP_001230709.1 hypothetical protein Toxin
N0M81_RS24330 (N0M81_24330) 7791..8033 + 243 WP_000151456.1 hypothetical protein Antitoxin
N0M81_RS24335 (N0M81_24335) 8604..8897 + 294 WP_000673428.1 hypothetical protein -
N0M81_RS24340 (N0M81_24340) 9386..9634 + 249 WP_000513532.1 type II toxin-antitoxin system HicA family toxin -
N0M81_RS24345 (N0M81_24345) 9631..9978 + 348 WP_000681609.1 type II toxin-antitoxin system HicB family antitoxin -
N0M81_RS24350 (N0M81_24350) 10066..10509 - 444 WP_023223351.1 hypothetical protein -
N0M81_RS24355 (N0M81_24355) 10750..11049 + 300 WP_034169410.1 type II toxin-antitoxin system HicB family antitoxin -
N0M81_RS24360 (N0M81_24360) 11309..11635 - 327 WP_000206697.1 hypothetical protein -
N0M81_RS24365 (N0M81_24365) 11637..11960 - 324 WP_223666488.1 hypothetical protein -
N0M81_RS24370 (N0M81_24370) 11937..12077 - 141 Protein_19 hypothetical protein -
N0M81_RS24375 (N0M81_24375) 12097..12804 - 708 WP_000108794.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..60959 60959


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T257146 WP_001230709.1 NZ_CP104081:7540-7794 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT257146 WP_000151456.1 NZ_CP104081:7791-8033 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References