Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 18435..19078 | Replicon | plasmid pHB42-3 |
Accession | NZ_CP104080 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | N0M81_RS24025 | Protein ID | WP_001044768.1 |
Coordinates | 18435..18851 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | N0M81_RS24030 | Protein ID | WP_001261287.1 |
Coordinates | 18848..19078 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS24010 (N0M81_24010) | 14934..15524 | - | 591 | WP_000194575.1 | hypothetical protein | - |
N0M81_RS24015 (N0M81_24015) | 15524..15781 | - | 258 | WP_000343085.1 | hypothetical protein | - |
N0M81_RS24020 (N0M81_24020) | 16135..18273 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
N0M81_RS24025 (N0M81_24025) | 18435..18851 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0M81_RS24030 (N0M81_24030) | 18848..19078 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0M81_RS24035 (N0M81_24035) | 19374..19664 | + | 291 | WP_000111771.1 | hypothetical protein | - |
N0M81_RS24040 (N0M81_24040) | 19654..20553 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
N0M81_RS24045 (N0M81_24045) | 20603..22594 | - | 1992 | WP_259904992.1 | KAP family NTPase | - |
N0M81_RS24050 (N0M81_24050) | 22548..22829 | - | 282 | WP_259904994.1 | KAP family NTPase | - |
N0M81_RS24055 (N0M81_24055) | 22831..23919 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..61731 | 61731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T257145 WP_001044768.1 NZ_CP104080:c18851-18435 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |