Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 31358..32001 | Replicon | plasmid pHB42-1 |
| Accession | NZ_CP104078 | ||
| Organism | Escherichia coli strain HB42 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | N0M81_RS22650 | Protein ID | WP_001034046.1 |
| Coordinates | 31358..31774 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | N0M81_RS22655 | Protein ID | WP_001261278.1 |
| Coordinates | 31771..32001 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0M81_RS22635 (26495) | 26495..26911 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| N0M81_RS22640 (26908) | 26908..27138 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| N0M81_RS22645 (27519) | 27519..31313 | + | 3795 | WP_259904975.1 | pcar | - |
| N0M81_RS22650 (31358) | 31358..31774 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0M81_RS22655 (31771) | 31771..32001 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N0M81_RS22660 (32266) | 32266..32766 | + | 501 | WP_000528931.1 | HEPN family nuclease | - |
| N0M81_RS22665 (32779) | 32779..33552 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| N0M81_RS22670 (33719) | 33719..34852 | + | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
| N0M81_RS22675 (34886) | 34886..35398 | - | 513 | WP_000151784.1 | hypothetical protein | - |
| N0M81_RS22680 (35938) | 35938..36288 | + | 351 | WP_000493378.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / mph(A) / fosA3 / blaCTX-M-14 / sitABCD | iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..154403 | 154403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T257136 WP_001034046.1 NZ_CP104078:c31774-31358 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |