Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 31358..32001 Replicon plasmid pHB42-1
Accession NZ_CP104078
Organism Escherichia coli strain HB42

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag N0M81_RS22650 Protein ID WP_001034046.1
Coordinates 31358..31774 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag N0M81_RS22655 Protein ID WP_001261278.1
Coordinates 31771..32001 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0M81_RS22635 (26495) 26495..26911 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
N0M81_RS22640 (26908) 26908..27138 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
N0M81_RS22645 (27519) 27519..31313 + 3795 WP_259904975.1 pcar -
N0M81_RS22650 (31358) 31358..31774 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
N0M81_RS22655 (31771) 31771..32001 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N0M81_RS22660 (32266) 32266..32766 + 501 WP_000528931.1 HEPN family nuclease -
N0M81_RS22665 (32779) 32779..33552 + 774 WP_000905949.1 hypothetical protein -
N0M81_RS22670 (33719) 33719..34852 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
N0M81_RS22675 (34886) 34886..35398 - 513 WP_000151784.1 hypothetical protein -
N0M81_RS22680 (35938) 35938..36288 + 351 WP_000493378.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / mph(A) / fosA3 / blaCTX-M-14 / sitABCD iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..154403 154403


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T257136 WP_001034046.1 NZ_CP104078:c31774-31358 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT257136 WP_001261278.1 NZ_CP104078:c32001-31771 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References