Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 26495..27138 Replicon plasmid pHB42-1
Accession NZ_CP104078
Organism Escherichia coli strain HB42

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag N0M81_RS22635 Protein ID WP_001034044.1
Coordinates 26495..26911 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag N0M81_RS22640 Protein ID WP_001261286.1
Coordinates 26908..27138 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0M81_RS22605 (22060) 22060..22125 - 66 Protein_27 EAL domain-containing protein -
N0M81_RS22610 (22169) 22169..22474 - 306 WP_000130000.1 PadR family transcriptional regulator -
N0M81_RS22615 (22484) 22484..22840 - 357 Protein_29 chromate transporter -
N0M81_RS22620 (22897) 22897..23594 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
N0M81_RS22625 (23848) 23848..24870 - 1023 WP_000361402.1 helicase UvrD -
N0M81_RS22630 (24855) 24855..26420 - 1566 WP_001128474.1 AAA family ATPase -
N0M81_RS22635 (26495) 26495..26911 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
N0M81_RS22640 (26908) 26908..27138 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N0M81_RS22645 (27519) 27519..31313 + 3795 WP_259904975.1 pcar -
N0M81_RS22650 (31358) 31358..31774 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
N0M81_RS22655 (31771) 31771..32001 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / mph(A) / fosA3 / blaCTX-M-14 / sitABCD iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..154403 154403


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T257135 WP_001034044.1 NZ_CP104078:c26911-26495 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT257135 WP_001261286.1 NZ_CP104078:c27138-26908 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References