Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 26495..27138 | Replicon | plasmid pHB42-1 |
| Accession | NZ_CP104078 | ||
| Organism | Escherichia coli strain HB42 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | N0M81_RS22635 | Protein ID | WP_001034044.1 |
| Coordinates | 26495..26911 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | N0M81_RS22640 | Protein ID | WP_001261286.1 |
| Coordinates | 26908..27138 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0M81_RS22605 (22060) | 22060..22125 | - | 66 | Protein_27 | EAL domain-containing protein | - |
| N0M81_RS22610 (22169) | 22169..22474 | - | 306 | WP_000130000.1 | PadR family transcriptional regulator | - |
| N0M81_RS22615 (22484) | 22484..22840 | - | 357 | Protein_29 | chromate transporter | - |
| N0M81_RS22620 (22897) | 22897..23594 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| N0M81_RS22625 (23848) | 23848..24870 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| N0M81_RS22630 (24855) | 24855..26420 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| N0M81_RS22635 (26495) | 26495..26911 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0M81_RS22640 (26908) | 26908..27138 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N0M81_RS22645 (27519) | 27519..31313 | + | 3795 | WP_259904975.1 | pcar | - |
| N0M81_RS22650 (31358) | 31358..31774 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| N0M81_RS22655 (31771) | 31771..32001 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / mph(A) / fosA3 / blaCTX-M-14 / sitABCD | iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..154403 | 154403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T257135 WP_001034044.1 NZ_CP104078:c26911-26495 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |