Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4492324..4492940 | Replicon | chromosome |
| Accession | NZ_CP104077 | ||
| Organism | Escherichia coli strain HB42 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A176ZIX8 |
| Locus tag | N0M81_RS21425 | Protein ID | WP_001129490.1 |
| Coordinates | 4492324..4492698 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1M0CY48 |
| Locus tag | N0M81_RS21430 | Protein ID | WP_001275523.1 |
| Coordinates | 4492698..4492940 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0M81_RS21410 (4489827) | 4489827..4490729 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| N0M81_RS21415 (4490726) | 4490726..4491361 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N0M81_RS21420 (4491358) | 4491358..4492287 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| N0M81_RS21425 (4492324) | 4492324..4492698 | - | 375 | WP_001129490.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N0M81_RS21430 (4492698) | 4492698..4492940 | - | 243 | WP_001275523.1 | CopG family transcriptional regulator | Antitoxin |
| N0M81_RS21435 (4493160) | 4493160..4493378 | - | 219 | WP_001251290.1 | CopG family transcriptional regulator | - |
| N0M81_RS21440 (4494052) | 4494052..4494966 | - | 915 | WP_072649161.1 | transposase | - |
| N0M81_RS21445 (4494979) | 4494979..4495866 | - | 888 | Protein_4188 | hypothetical protein | - |
| N0M81_RS21450 (4496282) | 4496282..4497223 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N0M81_RS21455 (4497268) | 4497268..4497705 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13960.19 Da Isoelectric Point: 7.0126
>T257134 WP_001129490.1 NZ_CP104077:c4492698-4492324 [Escherichia coli]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A176ZIX8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M0CY48 |