Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3471579..3472416 | Replicon | chromosome |
Accession | NZ_CP104077 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A1M0D5U3 |
Locus tag | N0M81_RS16600 | Protein ID | WP_000227782.1 |
Coordinates | 3471874..3472416 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | B1LJI1 |
Locus tag | N0M81_RS16595 | Protein ID | WP_001353405.1 |
Coordinates | 3471579..3471890 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS16570 (3466599) | 3466599..3467546 | + | 948 | WP_001239437.1 | cytochrome o ubiquinol oxidase subunit II | - |
N0M81_RS16575 (3467568) | 3467568..3469559 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
N0M81_RS16580 (3469549) | 3469549..3470163 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N0M81_RS16585 (3470163) | 3470163..3470492 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N0M81_RS16590 (3470504) | 3470504..3471394 | + | 891 | WP_000971327.1 | heme o synthase | - |
N0M81_RS16595 (3471579) | 3471579..3471890 | + | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
N0M81_RS16600 (3471874) | 3471874..3472416 | + | 543 | WP_000227782.1 | GNAT family N-acetyltransferase | Toxin |
N0M81_RS16605 (3472472) | 3472472..3473316 | - | 845 | Protein_3248 | sel1 repeat family protein | - |
N0M81_RS16610 (3473723) | 3473723..3475087 | + | 1365 | WP_001000978.1 | MFS transporter | - |
N0M81_RS16615 (3475215) | 3475215..3475706 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N0M81_RS16620 (3475874) | 3475874..3476785 | + | 912 | WP_000705841.1 | 2-dehydropantoate 2-reductase | - |
N0M81_RS16625 (3476748) | 3476748..3477338 | + | 591 | WP_001276320.1 | protein deglycase YajL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19957.31 Da Isoelectric Point: 9.1763
>T257129 WP_000227782.1 NZ_CP104077:3471874-3472416 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0D5U3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G7G3 |