Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3437491..3438109 | Replicon | chromosome |
Accession | NZ_CP104077 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N0M81_RS16430 | Protein ID | WP_001291435.1 |
Coordinates | 3437891..3438109 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N0M81_RS16425 | Protein ID | WP_000344800.1 |
Coordinates | 3437491..3437865 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS16415 (3432580) | 3432580..3433773 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N0M81_RS16420 (3433796) | 3433796..3436945 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N0M81_RS16425 (3437491) | 3437491..3437865 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N0M81_RS16430 (3437891) | 3437891..3438109 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N0M81_RS16435 (3438281) | 3438281..3438832 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
N0M81_RS16440 (3438948) | 3438948..3439418 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N0M81_RS16445 (3439582) | 3439582..3441132 | + | 1551 | WP_001361689.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N0M81_RS16450 (3441174) | 3441174..3441527 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N0M81_RS16460 (3441906) | 3441906..3442217 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N0M81_RS16465 (3442248) | 3442248..3442820 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T257128 WP_001291435.1 NZ_CP104077:3437891-3438109 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT257128 WP_000344800.1 NZ_CP104077:3437491-3437865 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |