Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3059896..3060601 | Replicon | chromosome |
Accession | NZ_CP104077 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1M2J6W7 |
Locus tag | N0M81_RS14625 | Protein ID | WP_000539524.1 |
Coordinates | 3059896..3060282 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N0M81_RS14630 | Protein ID | WP_001280945.1 |
Coordinates | 3060272..3060601 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS14605 (3055900) | 3055900..3056526 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
N0M81_RS14610 (3056523) | 3056523..3057638 | - | 1116 | WP_000555056.1 | aldose sugar dehydrogenase YliI | - |
N0M81_RS14615 (3057749) | 3057749..3058132 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N0M81_RS14620 (3058345) | 3058345..3059670 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N0M81_RS14625 (3059896) | 3059896..3060282 | + | 387 | WP_000539524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0M81_RS14630 (3060272) | 3060272..3060601 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N0M81_RS14635 (3060671) | 3060671..3061988 | - | 1318 | Protein_2870 | diguanylate cyclase | - |
N0M81_RS14640 (3061996) | 3061996..3064344 | - | 2349 | WP_000950331.1 | EAL domain-containing protein | - |
N0M81_RS14645 (3064521) | 3064521..3065432 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14321.46 Da Isoelectric Point: 9.9521
>T257126 WP_000539524.1 NZ_CP104077:3059896-3060282 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSRSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSRSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|