Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1902829..1903613 | Replicon | chromosome |
Accession | NZ_CP104077 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | N0M81_RS08940 | Protein ID | WP_000613626.1 |
Coordinates | 1902829..1903323 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | N0M81_RS08945 | Protein ID | WP_001110447.1 |
Coordinates | 1903320..1903613 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS08920 (1898022) | 1898022..1899119 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
N0M81_RS08925 (1899119) | 1899119..1900060 | + | 942 | WP_001305885.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
N0M81_RS08930 (1900126) | 1900126..1901769 | + | 1644 | WP_061092652.1 | flagellar hook-associated protein FlgK | - |
N0M81_RS08935 (1901781) | 1901781..1902734 | + | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
N0M81_RS08940 (1902829) | 1902829..1903323 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
N0M81_RS08945 (1903320) | 1903320..1903613 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
N0M81_RS08950 (1903746) | 1903746..1906931 | - | 3186 | WP_061092653.1 | ribonuclease E | - |
N0M81_RS08955 (1907504) | 1907504..1908463 | + | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T257120 WP_000613626.1 NZ_CP104077:c1903323-1902829 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|