Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 892642..893296 | Replicon | chromosome |
Accession | NZ_CP104077 | ||
Organism | Escherichia coli strain HB42 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N0M81_RS04360 | Protein ID | WP_000244781.1 |
Coordinates | 892889..893296 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N0M81_RS04355 | Protein ID | WP_000354046.1 |
Coordinates | 892642..892908 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0M81_RS04335 (888730) | 888730..890163 | - | 1434 | WP_001521235.1 | 6-phospho-beta-glucosidase BglA | - |
N0M81_RS04340 (890208) | 890208..890519 | + | 312 | WP_001182949.1 | N(4)-acetylcytidine aminohydrolase | - |
N0M81_RS04345 (890683) | 890683..891342 | + | 660 | WP_259904223.1 | hemolysin III family protein | - |
N0M81_RS04350 (891419) | 891419..892399 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
N0M81_RS04355 (892642) | 892642..892908 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N0M81_RS04360 (892889) | 892889..893296 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
N0M81_RS04365 (893336) | 893336..893857 | - | 522 | WP_001521233.1 | flavodoxin FldB | - |
N0M81_RS04370 (893969) | 893969..894865 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N0M81_RS04375 (894890) | 894890..895600 | + | 711 | WP_001521231.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N0M81_RS04380 (895606) | 895606..897339 | + | 1734 | WP_063117505.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T257118 WP_000244781.1 NZ_CP104077:892889-893296 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|