Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 211161..211773 | Replicon | chromosome |
| Accession | NZ_CP104077 | ||
| Organism | Escherichia coli strain HB42 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | N0M81_RS00990 | Protein ID | WP_000833473.1 |
| Coordinates | 211161..211346 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1M2IVK0 |
| Locus tag | N0M81_RS00995 | Protein ID | WP_000499742.1 |
| Coordinates | 211363..211773 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0M81_RS00975 (206627) | 206627..207922 | + | 1296 | WP_000985745.1 | Fic family protein | - |
| N0M81_RS00980 (208030) | 208030..209568 | + | 1539 | WP_000183978.1 | aldehyde dehydrogenase AldB | - |
| N0M81_RS00985 (209609) | 209609..210688 | - | 1080 | WP_000061475.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| N0M81_RS00990 (211161) | 211161..211346 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N0M81_RS00995 (211363) | 211363..211773 | + | 411 | WP_000499742.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N0M81_RS01000 (211885) | 211885..213864 | - | 1980 | WP_001026863.1 | glycoside hydrolase family 127 protein | - |
| N0M81_RS01005 (213875) | 213875..215275 | - | 1401 | WP_000204814.1 | MFS transporter | - |
| N0M81_RS01010 (215501) | 215501..216316 | + | 816 | WP_000891820.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T257114 WP_000833473.1 NZ_CP104077:211161-211346 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15242.13 Da Isoelectric Point: 4.4482
>AT257114 WP_000499742.1 NZ_CP104077:211363-211773 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9YXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2IVK0 |