Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 70840..71638 | Replicon | chromosome |
| Accession | NZ_CP104077 | ||
| Organism | Escherichia coli strain HB42 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | N0M81_RS00305 | Protein ID | WP_061092894.1 |
| Coordinates | 70840..71217 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N0M81_RS00310 | Protein ID | WP_061092893.1 |
| Coordinates | 71264..71638 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0M81_RS00275 (66203) | 66203..67126 | - | 924 | WP_000535959.1 | carboxylate/amino acid/amine transporter | - |
| N0M81_RS00280 (67237) | 67237..68421 | - | 1185 | WP_001172864.1 | sugar efflux transporter | - |
| N0M81_RS00285 (68820) | 68820..68981 | - | 162 | Protein_56 | virulence RhuM family protein | - |
| N0M81_RS00290 (69219) | 69219..70061 | - | 843 | WP_061092922.1 | DUF4942 domain-containing protein | - |
| N0M81_RS00295 (70146) | 70146..70343 | - | 198 | WP_012908799.1 | DUF957 domain-containing protein | - |
| N0M81_RS00300 (70355) | 70355..70843 | - | 489 | WP_061092895.1 | DUF5983 family protein | - |
| N0M81_RS00305 (70840) | 70840..71217 | - | 378 | WP_061092894.1 | TA system toxin CbtA family protein | Toxin |
| N0M81_RS00310 (71264) | 71264..71638 | - | 375 | WP_061092893.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N0M81_RS00315 (71801) | 71801..72022 | - | 222 | WP_061092892.1 | DUF987 domain-containing protein | - |
| N0M81_RS00320 (72085) | 72085..72561 | - | 477 | WP_001186188.1 | RadC family protein | - |
| N0M81_RS00325 (72576) | 72576..73055 | - | 480 | WP_000706978.1 | antirestriction protein | - |
| N0M81_RS00330 (73321) | 73321..74139 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| N0M81_RS00335 (74229) | 74229..74462 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| N0M81_RS00340 (74468) | 74468..75145 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| N0M81_RS00345 (75293) | 75293..75973 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 59494..85199 | 25705 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.15 Da Isoelectric Point: 7.8045
>T257113 WP_061092894.1 NZ_CP104077:c71217-70840 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13752.53 Da Isoelectric Point: 6.5924
>AT257113 WP_061092893.1 NZ_CP104077:c71638-71264 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNHLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNHLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLTVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|