Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 265657..266305 | Replicon | chromosome |
Accession | NZ_CP104071 | ||
Organism | Stenotrophomonas maltophilia strain ACYCb.6H |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0L8AET4 |
Locus tag | K7565_RS01175 | Protein ID | WP_010486984.1 |
Coordinates | 265657..265944 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A0U5HHQ5 |
Locus tag | K7565_RS01180 | Protein ID | WP_058979789.1 |
Coordinates | 266003..266305 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K7565_RS01145 (K7565_01145) | 261600..262391 | - | 792 | WP_227844239.1 | zinc-dependent peptidase | - |
K7565_RS01150 (K7565_01150) | 262358..262636 | - | 279 | WP_005411956.1 | hypothetical protein | - |
K7565_RS01155 (K7565_01155) | 262781..263749 | + | 969 | WP_019661841.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
K7565_RS01160 (K7565_01160) | 263746..264477 | + | 732 | WP_019661840.1 | type III pantothenate kinase | - |
K7565_RS01165 (K7565_01165) | 264487..265335 | + | 849 | WP_227844240.1 | SPOR domain-containing protein | - |
K7565_RS01175 (K7565_01175) | 265657..265944 | + | 288 | WP_010486984.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
K7565_RS01180 (K7565_01180) | 266003..266305 | + | 303 | WP_058979789.1 | putative addiction module antidote protein | Antitoxin |
K7565_RS01185 (K7565_01185) | 266474..266875 | - | 402 | WP_155028816.1 | hypothetical protein | - |
K7565_RS01190 (K7565_01190) | 267458..268228 | + | 771 | WP_227844241.1 | DUF3011 domain-containing protein | - |
K7565_RS01195 (K7565_01195) | 268253..268600 | - | 348 | WP_057503835.1 | hypothetical protein | - |
K7565_RS01200 (K7565_01200) | 268732..269652 | + | 921 | WP_111097684.1 | arginase | - |
K7565_RS01205 (K7565_01205) | 269815..269952 | + | 138 | WP_019661832.1 | entericidin A/B family lipoprotein | - |
K7565_RS01210 (K7565_01210) | 270154..270375 | + | 222 | WP_019661831.1 | CsbD family protein | - |
K7565_RS01215 (K7565_01215) | 270446..271246 | - | 801 | WP_227844242.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10744.34 Da Isoelectric Point: 10.8940
>T257112 WP_010486984.1 NZ_CP104071:265657-265944 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLADGVSELRIDAGPGYRVYYTQRGRQLVILLVGGDKGS
QQRDIEKAREIARAL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0L8AET4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0U5HHQ5 |