Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 26416..27050 Replicon plasmid unnamed2
Accession NZ_CP104069
Organism Alicyclobacillus fastidiosus strain DSM 17978

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NZD89_RS28950 Protein ID WP_268008884.1
Coordinates 26646..27050 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NZD89_RS28945 Protein ID WP_268008883.1
Coordinates 26416..26646 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZD89_RS28905 (NZD89_28915) 21793..21918 + 126 WP_268008875.1 hypothetical protein -
NZD89_RS28910 (NZD89_28920) 22003..22128 + 126 WP_268008876.1 hypothetical protein -
NZD89_RS28915 (NZD89_28925) 22249..22545 + 297 WP_268008877.1 hypothetical protein -
NZD89_RS28920 (NZD89_28930) 23216..23344 + 129 WP_268008878.1 hypothetical protein -
NZD89_RS28925 (NZD89_28935) 24167..24301 + 135 WP_268008879.1 hypothetical protein -
NZD89_RS28930 (NZD89_28940) 24341..24643 + 303 WP_268008880.1 hypothetical protein -
NZD89_RS28935 (NZD89_28945) 24903..25109 - 207 WP_268008881.1 hypothetical protein -
NZD89_RS28940 (NZD89_28950) 25106..25879 - 774 WP_268008882.1 hypothetical protein -
NZD89_RS28945 (NZD89_28955) 26416..26646 + 231 WP_268008883.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NZD89_RS28950 (NZD89_28960) 26646..27050 + 405 WP_268008884.1 type II toxin-antitoxin system VapC family toxin Toxin
NZD89_RS28955 (NZD89_28965) 27638..27802 + 165 WP_268008885.1 DUF4183 domain-containing protein -
NZD89_RS28960 (NZD89_28970) 27829..28122 + 294 WP_268008887.1 DUF4183 domain-containing protein -
NZD89_RS28965 (NZD89_28975) 28539..28832 + 294 WP_268008888.1 DUF4183 domain-containing protein -
NZD89_RS28970 (NZD89_28980) 29013..29906 - 894 WP_268008889.1 glycoside hydrolase family 25 protein -
NZD89_RS28975 (NZD89_28985) 30187..30648 + 462 WP_268008890.1 transposase -
NZD89_RS28980 (NZD89_28990) 30789..31445 - 657 WP_268008891.1 DUF4183 domain-containing protein -
NZD89_RS28985 (NZD89_28995) 31784..31924 - 141 WP_268008892.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..68553 68553


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-125)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15197.50 Da        Isoelectric Point: 5.2521

>T257111 WP_268008884.1 NZ_CP104069:26646-27050 [Alicyclobacillus fastidiosus]
MLYMLDTNICIYLIKKRSESLLKRMRVFHTGEIGVSVMTVAELQYGVSKSVNQERNQTALEAFLLPLEIAEFTTEATVVY
GRVRAELERQGRPIGPLDTLIAAHALSLDVPLVTNNTREFERVSGLRVENWTDE

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8885.02 Da        Isoelectric Point: 4.4501

>AT257111 WP_268008883.1 NZ_CP104069:26416-26646 [Alicyclobacillus fastidiosus]
MERAKLFQSGRSQAVRLPKEFRFNGTEVYVKRVGNAVVLLPMEDAWDSLAQSLELFSDDFMSERDQLAEQQREELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References