Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 5392971..5393580 | Replicon | chromosome |
| Accession | NZ_CP104067 | ||
| Organism | Alicyclobacillus fastidiosus strain DSM 17978 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NZD89_RS26245 | Protein ID | WP_268005580.1 |
| Coordinates | 5392971..5393321 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | NZD89_RS26250 | Protein ID | WP_268008623.1 |
| Coordinates | 5393326..5393580 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZD89_RS26215 (NZD89_26225) | 5388665..5389288 | + | 624 | WP_268005574.1 | DedA family protein | - |
| NZD89_RS26220 (NZD89_26230) | 5389661..5389879 | - | 219 | WP_268005575.1 | DUF2922 domain-containing protein | - |
| NZD89_RS26225 (NZD89_26235) | 5389926..5390165 | - | 240 | WP_268005576.1 | DUF1659 domain-containing protein | - |
| NZD89_RS26230 (NZD89_26240) | 5390412..5390717 | + | 306 | WP_268005577.1 | hypothetical protein | - |
| NZD89_RS26235 (NZD89_26245) | 5390862..5391596 | - | 735 | WP_268005578.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| NZD89_RS26240 (NZD89_26250) | 5391613..5392866 | - | 1254 | WP_268005579.1 | adenosylhomocysteinase | - |
| NZD89_RS26245 (NZD89_26255) | 5392971..5393321 | - | 351 | WP_268005580.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NZD89_RS26250 (NZD89_26260) | 5393326..5393580 | - | 255 | WP_268008623.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| NZD89_RS26255 (NZD89_26265) | 5393680..5394909 | - | 1230 | WP_268005581.1 | alanine racemase | - |
| NZD89_RS26260 (NZD89_26270) | 5395086..5396084 | - | 999 | WP_268008624.1 | outer membrane lipoprotein carrier protein LolA | - |
| NZD89_RS26265 (NZD89_26275) | 5396126..5397610 | - | 1485 | WP_268005582.1 | NAD(P)H-hydrate dehydratase | - |
| NZD89_RS26270 (NZD89_26280) | 5397703..5398080 | - | 378 | WP_268005583.1 | holo-ACP synthase | - |
| NZD89_RS26275 (NZD89_26285) | 5398214..5398402 | + | 189 | WP_268005584.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12843.95 Da Isoelectric Point: 5.6766
>T257110 WP_268005580.1 NZ_CP104067:c5393321-5392971 [Alicyclobacillus fastidiosus]
MNVKRGDVFFADLSPVVGSEQGGFRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIPAQPYGLERDSVVLLEQL
RTLDKQRLTDKITHLDDTMMKMVNDGLLISLGLVDF
MNVKRGDVFFADLSPVVGSEQGGFRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIPAQPYGLERDSVVLLEQL
RTLDKQRLTDKITHLDDTMMKMVNDGLLISLGLVDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|