Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 4243336..4243963 | Replicon | chromosome |
Accession | NZ_CP104064 | ||
Organism | Alicyclobacillus dauci strain DSM 28700 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NZD86_RS21280 | Protein ID | WP_268044047.1 |
Coordinates | 4243336..4243686 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NZD86_RS21285 | Protein ID | WP_268044048.1 |
Coordinates | 4243691..4243963 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NZD86_RS21260 (NZD86_21280) | 4238449..4240224 | - | 1776 | WP_268044043.1 | PAS domain-containing protein | - |
NZD86_RS21265 (NZD86_21285) | 4240426..4240590 | - | 165 | WP_268044044.1 | hypothetical protein | - |
NZD86_RS21270 (NZD86_21290) | 4241118..4241858 | - | 741 | WP_268044045.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
NZD86_RS21275 (NZD86_21295) | 4241890..4243143 | - | 1254 | WP_268044046.1 | adenosylhomocysteinase | - |
NZD86_RS21280 (NZD86_21300) | 4243336..4243686 | - | 351 | WP_268044047.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NZD86_RS21285 (NZD86_21305) | 4243691..4243963 | - | 273 | WP_268044048.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NZD86_RS21290 (NZD86_21310) | 4244042..4245247 | - | 1206 | WP_268044050.1 | alanine racemase | - |
NZD86_RS21295 (NZD86_21315) | 4245652..4246650 | - | 999 | WP_268046994.1 | outer membrane lipoprotein carrier protein LolA | - |
NZD86_RS21300 (NZD86_21320) | 4246691..4248166 | - | 1476 | WP_268044051.1 | NAD(P)H-hydrate dehydratase | - |
NZD86_RS21305 (NZD86_21325) | 4248265..4248642 | - | 378 | WP_268044052.1 | holo-ACP synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12949.10 Da Isoelectric Point: 6.4667
>T257109 WP_268044047.1 NZ_CP104064:c4243686-4243336 [Alicyclobacillus dauci]
MNVKRGDIFFADLSPVVGSEQGGFRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIPAQRYGLERDSVVLLEQL
RTLDKQRLTDKITHLDETMMKMVNDGLMISLGLVDF
MNVKRGDIFFADLSPVVGSEQGGFRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIPAQRYGLERDSVVLLEQL
RTLDKQRLTDKITHLDETMMKMVNDGLMISLGLVDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|