Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4648909..4649552 | Replicon | chromosome |
Accession | NZ_CP104049 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain Sal-FJ2064 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | NXZ70_RS22655 | Protein ID | WP_000048134.1 |
Coordinates | 4648909..4649325 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | NXZ70_RS22660 | Protein ID | WP_001261294.1 |
Coordinates | 4649322..4649552 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXZ70_RS22635 (4643946) | 4643946..4645079 | + | 1134 | WP_023224151.1 | amidohydrolase/deacetylase family metallohydrolase | - |
NXZ70_RS22640 (4645063) | 4645063..4646181 | + | 1119 | WP_023224150.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NXZ70_RS22645 (4646178) | 4646178..4646918 | + | 741 | WP_000779255.1 | KDGP aldolase family protein | - |
NXZ70_RS22650 (4646935) | 4646935..4648848 | + | 1914 | WP_001212148.1 | BglG family transcription antiterminator | - |
NXZ70_RS22655 (4648909) | 4648909..4649325 | - | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NXZ70_RS22660 (4649322) | 4649322..4649552 | - | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NXZ70_RS22665 (4649720) | 4649720..4650184 | - | 465 | WP_001009178.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NXZ70_RS22670 (4650401) | 4650401..4652539 | - | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T257108 WP_000048134.1 NZ_CP104049:c4649325-4648909 [Salmonella enterica subsp. enterica serovar Kentucky]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |