Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3494480..3495140 | Replicon | chromosome |
Accession | NZ_CP104049 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain Sal-FJ2064 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | NXZ70_RS16935 | Protein ID | WP_000244756.1 |
Coordinates | 3494480..3494893 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NXZ70_RS16940 | Protein ID | WP_000351186.1 |
Coordinates | 3494874..3495140 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXZ70_RS16915 (3490421) | 3490421..3492154 | - | 1734 | WP_023223830.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NXZ70_RS16920 (3492160) | 3492160..3492873 | - | 714 | WP_023223829.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NXZ70_RS16925 (3492897) | 3492897..3493793 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NXZ70_RS16930 (3493906) | 3493906..3494427 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
NXZ70_RS16935 (3494480) | 3494480..3494893 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
NXZ70_RS16940 (3494874) | 3494874..3495140 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NXZ70_RS16945 (3495390) | 3495390..3496370 | + | 981 | WP_000874178.1 | tRNA-modifying protein YgfZ | - |
NXZ70_RS16950 (3496486) | 3496486..3497145 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
NXZ70_RS16955 (3497309) | 3497309..3497620 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
NXZ70_RS16960 (3497778) | 3497778..3499211 | + | 1434 | WP_001230143.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T257103 WP_000244756.1 NZ_CP104049:c3494893-3494480 [Salmonella enterica subsp. enterica serovar Kentucky]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT257103 WP_000351186.1 NZ_CP104049:c3495140-3494874 [Salmonella enterica subsp. enterica serovar Kentucky]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |