Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 1968968..1969490 | Replicon | chromosome |
Accession | NZ_CP104049 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain Sal-FJ2064 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NXZ70_RS09625 | Protein ID | WP_000221345.1 |
Coordinates | 1968968..1969252 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NXZ70_RS09630 | Protein ID | WP_000885424.1 |
Coordinates | 1969242..1969490 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NXZ70_RS09605 (1965043) | 1965043..1966551 | - | 1509 | WP_023223898.1 | FAD-dependent oxidoreductase | - |
NXZ70_RS09610 (1966596) | 1966596..1967084 | + | 489 | WP_023223899.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NXZ70_RS09615 (1967277) | 1967277..1968356 | + | 1080 | WP_023203126.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NXZ70_RS09620 (1968408) | 1968408..1968797 | - | 390 | WP_000194089.1 | RidA family protein | - |
NXZ70_RS09625 (1968968) | 1968968..1969252 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NXZ70_RS09630 (1969242) | 1969242..1969490 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NXZ70_RS09635 (1969642) | 1969642..1969761 | + | 120 | Protein_1886 | type II and III secretion system | - |
NXZ70_RS09640 (1969847) | 1969847..1970178 | + | 332 | Protein_1887 | DUF1493 family protein | - |
NXZ70_RS09645 (1970451) | 1970451..1971359 | + | 909 | WP_077906523.1 | hypothetical protein | - |
NXZ70_RS09650 (1971361) | 1971361..1972100 | - | 740 | Protein_1889 | hypothetical protein | - |
NXZ70_RS09655 (1972466) | 1972466..1972654 | - | 189 | WP_001276021.1 | DUF29 family protein | - |
NXZ70_RS09660 (1973056) | 1973056..1973784 | + | 729 | WP_240856007.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1967277..1978971 | 11694 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T257097 WP_000221345.1 NZ_CP104049:c1969252-1968968 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |