Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 3469883..3470352 | Replicon | chromosome |
Accession | NZ_CP104045 | ||
Organism | Pseudomonas sp. FJ2-5-13 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N2A98_RS15010 | Protein ID | WP_044273978.1 |
Coordinates | 3469883..3470158 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1T1I1G5 |
Locus tag | N2A98_RS15015 | Protein ID | WP_044273976.1 |
Coordinates | 3470158..3470352 (-) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2A98_RS14990 (N2A98_15010) | 3464885..3466129 | - | 1245 | WP_137204451.1 | zinc-dependent alcohol dehydrogenase | - |
N2A98_RS14995 (N2A98_15015) | 3466214..3467332 | - | 1119 | WP_275623613.1 | carboxylate-amine ligase | - |
N2A98_RS15000 (N2A98_15020) | 3467339..3468283 | - | 945 | WP_047711124.1 | class I SAM-dependent methyltransferase | - |
N2A98_RS15005 (N2A98_15025) | 3468295..3469674 | - | 1380 | WP_275622229.1 | iron-containing redox enzyme family protein | - |
N2A98_RS15010 (N2A98_15030) | 3469883..3470158 | - | 276 | WP_044273978.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N2A98_RS15015 (N2A98_15035) | 3470158..3470352 | - | 195 | WP_044273976.1 | hypothetical protein | Antitoxin |
N2A98_RS15020 (N2A98_15040) | 3470500..3472242 | - | 1743 | WP_003192009.1 | ABC transporter substrate-binding protein | - |
N2A98_RS15025 (N2A98_15045) | 3472401..3472673 | - | 273 | WP_014718862.1 | DUF2160 domain-containing protein | - |
N2A98_RS15030 (N2A98_15050) | 3472685..3473485 | - | 801 | WP_044273973.1 | carbohydrate ABC transporter permease | - |
N2A98_RS15035 (N2A98_15055) | 3473496..3474362 | - | 867 | WP_005789024.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10303.91 Da Isoelectric Point: 6.2166
>T257088 WP_044273978.1 NZ_CP104045:c3470158-3469883 [Pseudomonas sp. FJ2-5-13]
MLSVVWLDEAISDLIDIVTFIAAENPGAARRIKTRLEGAPLPLTEHPYLYPNGRVPGTREVVVHPNYVLVYRVTAERIEI
VNVLHARQEYP
MLSVVWLDEAISDLIDIVTFIAAENPGAARRIKTRLEGAPLPLTEHPYLYPNGRVPGTREVVVHPNYVLVYRVTAERIEI
VNVLHARQEYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|