Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parE_1-relB/RelE(toxin)
Location 1217975..1218422 Replicon chromosome
Accession NZ_CP104045
Organism Pseudomonas sp. FJ2-5-13

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag N2A98_RS05405 Protein ID WP_078466755.1
Coordinates 1218153..1218422 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0W0ND88
Locus tag N2A98_RS05400 Protein ID WP_014717050.1
Coordinates 1217975..1218163 (+) Length 63 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2A98_RS05375 (N2A98_05375) 1213443..1214795 + 1353 WP_044272018.1 aromatic acid/H+ symport family MFS transporter -
N2A98_RS05380 (N2A98_05380) 1214832..1215635 - 804 WP_275623112.1 transglutaminase family protein -
N2A98_RS05385 (N2A98_05385) 1215822..1216841 + 1020 WP_044272022.1 Glu/Leu/Phe/Val dehydrogenase dimerization domain-containing protein -
N2A98_RS05390 (N2A98_05390) 1216897..1217157 - 261 WP_003188807.1 YebG family protein -
N2A98_RS05395 (N2A98_05395) 1217578..1217823 + 246 WP_153474992.1 DUF6124 family protein -
N2A98_RS05400 (N2A98_05400) 1217975..1218163 + 189 WP_014717050.1 hypothetical protein Antitoxin
N2A98_RS05405 (N2A98_05405) 1218153..1218422 + 270 WP_078466755.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N2A98_RS05410 (N2A98_05410) 1218592..1218843 + 252 Protein_1057 phosphate-starvation-inducible PsiE family protein -
N2A98_RS05415 (N2A98_05415) 1218925..1219395 + 471 WP_275623113.1 phosphate-starvation-inducible PsiE family protein -
N2A98_RS05420 (N2A98_05420) 1219625..1220044 - 420 WP_275623114.1 adenylyltransferase/cytidyltransferase family protein -
N2A98_RS05425 (N2A98_05425) 1220050..1221009 - 960 WP_275623115.1 hypothetical protein -
N2A98_RS05430 (N2A98_05430) 1221011..1221562 + 552 WP_275623116.1 hypothetical protein -
N2A98_RS05435 (N2A98_05435) 1222184..1222909 - 726 WP_275623117.1 hypothetical protein -
N2A98_RS05440 (N2A98_05440) 1223119..1223397 - 279 WP_275623118.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10312.09 Da        Isoelectric Point: 11.3215

>T257087 WP_078466755.1 NZ_CP104045:1218153-1218422 [Pseudomonas sp. FJ2-5-13]
MLIEWSPAARVELRQIIDYLSHRNPAAALQLKRSIEASVLALSRRPHLYRPGRIGGTREMVVHPNYLVVYKVTDNIRILS
VLHARQRYP

Download         Length: 270 bp

Antitoxin


Download         Length: 63 a.a.        Molecular weight: 6884.55 Da        Isoelectric Point: 4.0061

>AT257087 WP_014717050.1 NZ_CP104045:1217975-1218163 [Pseudomonas sp. FJ2-5-13]
MDTSFSSGIQADIEEQADSYDRWFRARVQAALDDPSPGIPHDEVMAEMQALIESKLKKGDAD

Download         Length: 189 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0W0ND88

References