Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parE_1-relB/RelE(toxin) |
| Location | 1217975..1218422 | Replicon | chromosome |
| Accession | NZ_CP104045 | ||
| Organism | Pseudomonas sp. FJ2-5-13 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | - |
| Locus tag | N2A98_RS05405 | Protein ID | WP_078466755.1 |
| Coordinates | 1218153..1218422 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0W0ND88 |
| Locus tag | N2A98_RS05400 | Protein ID | WP_014717050.1 |
| Coordinates | 1217975..1218163 (+) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2A98_RS05375 (N2A98_05375) | 1213443..1214795 | + | 1353 | WP_044272018.1 | aromatic acid/H+ symport family MFS transporter | - |
| N2A98_RS05380 (N2A98_05380) | 1214832..1215635 | - | 804 | WP_275623112.1 | transglutaminase family protein | - |
| N2A98_RS05385 (N2A98_05385) | 1215822..1216841 | + | 1020 | WP_044272022.1 | Glu/Leu/Phe/Val dehydrogenase dimerization domain-containing protein | - |
| N2A98_RS05390 (N2A98_05390) | 1216897..1217157 | - | 261 | WP_003188807.1 | YebG family protein | - |
| N2A98_RS05395 (N2A98_05395) | 1217578..1217823 | + | 246 | WP_153474992.1 | DUF6124 family protein | - |
| N2A98_RS05400 (N2A98_05400) | 1217975..1218163 | + | 189 | WP_014717050.1 | hypothetical protein | Antitoxin |
| N2A98_RS05405 (N2A98_05405) | 1218153..1218422 | + | 270 | WP_078466755.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2A98_RS05410 (N2A98_05410) | 1218592..1218843 | + | 252 | Protein_1057 | phosphate-starvation-inducible PsiE family protein | - |
| N2A98_RS05415 (N2A98_05415) | 1218925..1219395 | + | 471 | WP_275623113.1 | phosphate-starvation-inducible PsiE family protein | - |
| N2A98_RS05420 (N2A98_05420) | 1219625..1220044 | - | 420 | WP_275623114.1 | adenylyltransferase/cytidyltransferase family protein | - |
| N2A98_RS05425 (N2A98_05425) | 1220050..1221009 | - | 960 | WP_275623115.1 | hypothetical protein | - |
| N2A98_RS05430 (N2A98_05430) | 1221011..1221562 | + | 552 | WP_275623116.1 | hypothetical protein | - |
| N2A98_RS05435 (N2A98_05435) | 1222184..1222909 | - | 726 | WP_275623117.1 | hypothetical protein | - |
| N2A98_RS05440 (N2A98_05440) | 1223119..1223397 | - | 279 | WP_275623118.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10312.09 Da Isoelectric Point: 11.3215
>T257087 WP_078466755.1 NZ_CP104045:1218153-1218422 [Pseudomonas sp. FJ2-5-13]
MLIEWSPAARVELRQIIDYLSHRNPAAALQLKRSIEASVLALSRRPHLYRPGRIGGTREMVVHPNYLVVYKVTDNIRILS
VLHARQRYP
MLIEWSPAARVELRQIIDYLSHRNPAAALQLKRSIEASVLALSRRPHLYRPGRIGGTREMVVHPNYLVVYKVTDNIRILS
VLHARQRYP
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|