Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 970173..970714 | Replicon | chromosome |
Accession | NZ_CP104045 | ||
Organism | Pseudomonas sp. FJ2-5-13 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N2A98_RS04285 | Protein ID | WP_200888182.1 |
Coordinates | 970439..970714 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A921NKV7 |
Locus tag | N2A98_RS04280 | Protein ID | WP_032893597.1 |
Coordinates | 970173..970439 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2A98_RS04265 (N2A98_04265) | 966082..968382 | - | 2301 | WP_069557486.1 | TonB-dependent siderophore receptor | - |
N2A98_RS04270 (N2A98_04270) | 968588..969268 | + | 681 | WP_275623067.1 | Fe2+-dependent dioxygenase | - |
N2A98_RS04275 (N2A98_04275) | 969271..970029 | + | 759 | WP_275623068.1 | tetratricopeptide repeat protein | - |
N2A98_RS04280 (N2A98_04280) | 970173..970439 | + | 267 | WP_032893597.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
N2A98_RS04285 (N2A98_04285) | 970439..970714 | + | 276 | WP_200888182.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N2A98_RS04290 (N2A98_04290) | 970781..971944 | - | 1164 | WP_014716890.1 | type III PLP-dependent enzyme | - |
N2A98_RS04295 (N2A98_04295) | 972399..973556 | - | 1158 | WP_275623069.1 | ABC transporter ATP-binding protein | - |
N2A98_RS04300 (N2A98_04300) | 973553..974206 | - | 654 | WP_003188473.1 | ABC transporter permease | - |
N2A98_RS04305 (N2A98_04305) | 974219..975112 | - | 894 | WP_044271547.1 | glycine betaine ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10903.44 Da Isoelectric Point: 7.2026
>T257086 WP_200888182.1 NZ_CP104045:970439-970714 [Pseudomonas sp. FJ2-5-13]
MELRWTSKALSDLTRLYDFLSVVNREAAARIVQSLSQAPDTLLDNPRIGERIEEFSPRDVRRLLVGHYEMRYEIQQSTLY
ILRLWHVREDR
MELRWTSKALSDLTRLYDFLSVVNREAAARIVQSLSQAPDTLLDNPRIGERIEEFSPRDVRRLLVGHYEMRYEIQQSTLY
ILRLWHVREDR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|