Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 296500..297137 Replicon chromosome
Accession NZ_CP104044
Organism Pseudomonas sp. SD17-1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N0B28_RS01370 Protein ID WP_213606734.1
Coordinates 296500..296682 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N0B28_RS01375 Protein ID WP_213606736.1
Coordinates 296712..297137 (+) Length 142 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0B28_RS01345 (N0B28_01345) 292028..292855 + 828 WP_043859807.1 DUF2314 domain-containing protein -
N0B28_RS01350 (N0B28_01350) 293290..293577 - 288 WP_043859808.1 HigA family addiction module antitoxin -
N0B28_RS01355 (N0B28_01355) 293590..293868 - 279 WP_043859809.1 type II toxin-antitoxin system RelE/ParE family toxin -
N0B28_RS01360 (N0B28_01360) 294779..295744 + 966 WP_275729960.1 hypothetical protein -
N0B28_RS01365 (N0B28_01365) 295792..296340 - 549 Protein_265 hypothetical protein -
N0B28_RS01370 (N0B28_01370) 296500..296682 + 183 WP_213606734.1 type II toxin-antitoxin system HicA family toxin Toxin
N0B28_RS01375 (N0B28_01375) 296712..297137 + 426 WP_213606736.1 helix-turn-helix domain-containing protein Antitoxin
N0B28_RS01385 (N0B28_01385) 297414..297677 - 264 WP_054915796.1 hypothetical protein -
N0B28_RS01390 (N0B28_01390) 297716..298096 - 381 WP_043862226.1 hypothetical protein -
N0B28_RS01395 (N0B28_01395) 298114..298320 - 207 WP_043862225.1 helix-turn-helix transcriptional regulator -
N0B28_RS01400 (N0B28_01400) 298330..298908 - 579 WP_043862224.1 hypothetical protein -
N0B28_RS01405 (N0B28_01405) 299430..299789 + 360 WP_210013913.1 SMR family transporter -
N0B28_RS01410 (N0B28_01410) 299783..300112 + 330 WP_043862222.1 multidrug/spermidine efflux SMR transporter subunit MdtI -
N0B28_RS01415 (N0B28_01415) 300340..301548 - 1209 WP_275729969.1 methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 291349..303727 12378


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

Cro/C1-type helix-turn-helix domain

(82-112)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6929.03 Da        Isoelectric Point: 10.8497

>T257084 WP_213606734.1 NZ_CP104044:296500-296682 [Pseudomonas sp. SD17-1]
MKYSEFRRWLRAHGVTFVPAKGSHFKVYLGNRQTIFPDHGAKEISEGLRRKIIKDLGLGD

Download         Length: 183 bp

Antitoxin


Download         Length: 142 a.a.        Molecular weight: 15412.69 Da        Isoelectric Point: 4.7523

>AT257084 WP_213606736.1 NZ_CP104044:296712-297137 [Pseudomonas sp. SD17-1]
MYDYPVTVHEEEGGPWVSCADVPEMSSAGDTVEEALFDAVDALESALSFYVDQRIAIPLPSPPALGQPVVRLPALTAAKA
ALWNTMIKQKVTKTELARRLGVNRPQVDRLVDLLHRSKIEQVEHALQVLGQRIELSVVAAS

Download         Length: 426 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References