Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/CC2985(antitoxin)
Location 441216..441748 Replicon plasmid pWSM4643_2
Accession NZ_CP104042
Organism Rhizobium leguminosarum bv. viciae strain WSM4643

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag N1937_RS28950 Protein ID WP_260059890.1
Coordinates 441216..441509 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag N1937_RS28955 Protein ID WP_260059891.1
Coordinates 441506..441748 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1937_RS28930 (N1937_28930) 436387..437985 + 1599 WP_260059887.1 MFS transporter -
N1937_RS28935 (N1937_28935) 438120..438956 + 837 WP_260059888.1 alpha/beta hydrolase -
N1937_RS28940 (N1937_28940) 439091..439996 - 906 WP_260059889.1 AraC family transcriptional regulator -
N1937_RS28945 (N1937_28945) 440289..441122 + 834 WP_260060246.1 AraC family transcriptional regulator -
N1937_RS28950 (N1937_28950) 441216..441509 - 294 WP_260059890.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N1937_RS28955 (N1937_28955) 441506..441748 - 243 WP_260059891.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
N1937_RS28960 (N1937_28960) 441996..442886 - 891 WP_260059892.1 LysR family transcriptional regulator -
N1937_RS28965 (N1937_28965) 443004..443264 + 261 WP_260059894.1 helix-turn-helix transcriptional regulator -
N1937_RS28970 (N1937_28970) 443378..443767 - 390 WP_260059896.1 RidA family protein -
N1937_RS28975 (N1937_28975) 444085..444843 - 759 WP_260059897.1 alpha/beta hydrolase -
N1937_RS28980 (N1937_28980) 444951..445674 - 724 Protein_431 L,D-transpeptidase -
N1937_RS28985 (N1937_28985) 445677..446207 - 531 WP_260059899.1 VOC family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - gmd 1..548967 548967


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11158.71 Da        Isoelectric Point: 5.1579

>T257081 WP_260059890.1 NZ_CP104042:c441509-441216 [Rhizobium leguminosarum bv. viciae]
MSFKLSAEAAEDIIAIAEQGVRMFGAGTAKRYHDELFALFDLIAVNPRIARERDEIDPPVRIHPFKAHLVVYRIEDDETI
FVIRIRHAHEDWATDSI

Download         Length: 294 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8921.07 Da        Isoelectric Point: 9.7765

>AT257081 WP_260059891.1 NZ_CP104042:c441748-441506 [Rhizobium leguminosarum bv. viciae]
MATMNVSLPRPMKDWVEAQARTGRYSNASDYVRDLIRRDQTRNDKIAAMQSFVEAGLQSGLGIQSKDELFAEAIARASKS

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References