Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 441216..441748 | Replicon | plasmid pWSM4643_2 |
| Accession | NZ_CP104042 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain WSM4643 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N1937_RS28950 | Protein ID | WP_260059890.1 |
| Coordinates | 441216..441509 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | N1937_RS28955 | Protein ID | WP_260059891.1 |
| Coordinates | 441506..441748 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1937_RS28930 (N1937_28930) | 436387..437985 | + | 1599 | WP_260059887.1 | MFS transporter | - |
| N1937_RS28935 (N1937_28935) | 438120..438956 | + | 837 | WP_260059888.1 | alpha/beta hydrolase | - |
| N1937_RS28940 (N1937_28940) | 439091..439996 | - | 906 | WP_260059889.1 | AraC family transcriptional regulator | - |
| N1937_RS28945 (N1937_28945) | 440289..441122 | + | 834 | WP_260060246.1 | AraC family transcriptional regulator | - |
| N1937_RS28950 (N1937_28950) | 441216..441509 | - | 294 | WP_260059890.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N1937_RS28955 (N1937_28955) | 441506..441748 | - | 243 | WP_260059891.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| N1937_RS28960 (N1937_28960) | 441996..442886 | - | 891 | WP_260059892.1 | LysR family transcriptional regulator | - |
| N1937_RS28965 (N1937_28965) | 443004..443264 | + | 261 | WP_260059894.1 | helix-turn-helix transcriptional regulator | - |
| N1937_RS28970 (N1937_28970) | 443378..443767 | - | 390 | WP_260059896.1 | RidA family protein | - |
| N1937_RS28975 (N1937_28975) | 444085..444843 | - | 759 | WP_260059897.1 | alpha/beta hydrolase | - |
| N1937_RS28980 (N1937_28980) | 444951..445674 | - | 724 | Protein_431 | L,D-transpeptidase | - |
| N1937_RS28985 (N1937_28985) | 445677..446207 | - | 531 | WP_260059899.1 | VOC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | gmd | 1..548967 | 548967 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11158.71 Da Isoelectric Point: 5.1579
>T257081 WP_260059890.1 NZ_CP104042:c441509-441216 [Rhizobium leguminosarum bv. viciae]
MSFKLSAEAAEDIIAIAEQGVRMFGAGTAKRYHDELFALFDLIAVNPRIARERDEIDPPVRIHPFKAHLVVYRIEDDETI
FVIRIRHAHEDWATDSI
MSFKLSAEAAEDIIAIAEQGVRMFGAGTAKRYHDELFALFDLIAVNPRIARERDEIDPPVRIHPFKAHLVVYRIEDDETI
FVIRIRHAHEDWATDSI
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|