Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 297815..298617 | Replicon | plasmid pWSM4643_1 |
Accession | NZ_CP104041 | ||
Organism | Rhizobium leguminosarum bv. viciae strain WSM4643 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | - |
Locus tag | N1937_RS25310 | Protein ID | WP_260059686.1 |
Coordinates | 298090..298617 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | - |
Locus tag | N1937_RS25305 | Protein ID | WP_170280972.1 |
Coordinates | 297815..298093 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1937_RS25285 (N1937_25285) | 293041..294561 | - | 1521 | WP_260059684.1 | ABC transporter substrate-binding protein | - |
N1937_RS25290 (N1937_25290) | 294775..295560 | + | 786 | WP_170255606.1 | IclR family transcriptional regulator | - |
N1937_RS25295 (N1937_25295) | 295631..296353 | + | 723 | WP_017967670.1 | ribonuclease activity regulator RraA | - |
N1937_RS25300 (N1937_25300) | 296780..297610 | + | 831 | WP_260059706.1 | DUF6030 family protein | - |
N1937_RS25305 (N1937_25305) | 297815..298093 | + | 279 | WP_170280972.1 | DUF1778 domain-containing protein | Antitoxin |
N1937_RS25310 (N1937_25310) | 298090..298617 | + | 528 | WP_260059686.1 | GNAT family N-acetyltransferase | Toxin |
N1937_RS25315 (N1937_25315) | 298764..299108 | - | 345 | WP_260059687.1 | hypothetical protein | - |
N1937_RS25320 (N1937_25320) | 299496..300017 | + | 522 | WP_026154513.1 | tetratricopeptide repeat protein | - |
N1937_RS25325 (N1937_25325) | 300229..300789 | - | 561 | WP_260059688.1 | hypothetical protein | - |
N1937_RS25330 (N1937_25330) | 300869..302173 | - | 1305 | WP_260059689.1 | AAA family ATPase | - |
N1937_RS25335 (N1937_25335) | 302188..303129 | - | 942 | WP_222385901.1 | type II secretion system F family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..627412 | 627412 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 18706.71 Da Isoelectric Point: 8.8575
>T257079 WP_260059686.1 NZ_CP104041:298090-298617 [Rhizobium leguminosarum bv. viciae]
VTLPVWHEEPIAKSHDRAAFDCGDAAMNEFIRRFARQSHEQNAAKTFCAIDKAQPDCILGFYTVAPSAVTHEAVPPKMTR
GLARHEVAGFKLARLATDIKVAGKGLGGQLIAAAALRCLRLASEGGGILLIIDAKSERAAHWYAGYGAEPLQGKPLTLVM
PLATFAADFKAKGLL
VTLPVWHEEPIAKSHDRAAFDCGDAAMNEFIRRFARQSHEQNAAKTFCAIDKAQPDCILGFYTVAPSAVTHEAVPPKMTR
GLARHEVAGFKLARLATDIKVAGKGLGGQLIAAAALRCLRLASEGGGILLIIDAKSERAAHWYAGYGAEPLQGKPLTLVM
PLATFAADFKAKGLL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|