Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 57619..58295 Replicon plasmid pWSM4643_1
Accession NZ_CP104041
Organism Rhizobium leguminosarum bv. viciae strain WSM4643

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N1937_RS24175 Protein ID WP_260059493.1
Coordinates 57870..58295 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N1937_RS24170 Protein ID WP_260059698.1
Coordinates 57619..57873 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1937_RS24135 (N1937_24135) 52782..52913 - 132 Protein_49 EF-hand domain-containing protein -
N1937_RS24140 (N1937_24140) 53075..53719 + 645 WP_017967326.1 TetR/AcrR family transcriptional regulator -
N1937_RS24145 (N1937_24145) 53756..53953 + 198 Protein_51 DUF1217 domain-containing protein -
N1937_RS24150 (N1937_24150) 54399..55238 + 840 WP_017967324.1 transporter substrate-binding domain-containing protein -
N1937_RS24155 (N1937_24155) 55355..56017 + 663 WP_017967323.1 amino acid ABC transporter permease -
N1937_RS24160 (N1937_24160) 56023..56682 + 660 WP_017967322.1 amino acid ABC transporter permease -
N1937_RS24165 (N1937_24165) 56694..57464 + 771 WP_170258387.1 amino acid ABC transporter ATP-binding protein -
N1937_RS24170 (N1937_24170) 57619..57873 + 255 WP_260059698.1 plasmid stabilization protein Antitoxin
N1937_RS24175 (N1937_24175) 57870..58295 + 426 WP_260059493.1 type II toxin-antitoxin system VapC family toxin Toxin
N1937_RS24180 (N1937_24180) 58490..59251 + 762 WP_260059495.1 GntR family transcriptional regulator -
N1937_RS24185 (N1937_24185) 59245..60030 + 786 WP_260059497.1 transporter substrate-binding domain-containing protein -
N1937_RS24190 (N1937_24190) 60110..60781 + 672 WP_170275893.1 amino acid ABC transporter permease -
N1937_RS24195 (N1937_24195) 60778..61437 + 660 WP_260059500.1 amino acid ABC transporter permease -
N1937_RS24200 (N1937_24200) 61415..62140 + 726 WP_170259719.1 amino acid ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..627412 627412


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15036.21 Da        Isoelectric Point: 4.5882

>T257078 WP_260059493.1 NZ_CP104041:57870-58295 [Rhizobium leguminosarum bv. viciae]
VIILDTNVVSEAMKPAPDETVKFWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARTAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA

Download         Length: 426 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9290.60 Da        Isoelectric Point: 9.0495

>AT257078 WP_260059698.1 NZ_CP104041:57619-57873 [Rhizobium leguminosarum bv. viciae]
MPAVTIRNLSEATHRALKVRAAHHGRSTEAEMREILEAAVRPETRLHLGSALAERSRRLGLTNEDLAVLDQARDALPAKP
LSFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References