Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/CC2985(antitoxin)
Location 115972..116504 Replicon plasmid pSRDI969_4
Accession NZ_CP104039
Organism Rhizobium leguminosarum bv. viciae strain SRDI969

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag N2A41_RS32235 Protein ID WP_222384816.1
Coordinates 115972..116265 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag N2A41_RS32240 Protein ID WP_131664786.1
Coordinates 116262..116504 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2A41_RS32220 (N2A41_32220) 112088..113437 + 1350 WP_260112151.1 8-oxoguanine deaminase -
N2A41_RS32225 (N2A41_32225) 113447..114679 + 1233 WP_260112152.1 amidohydrolase family protein -
N2A41_RS32230 (N2A41_32230) 115130..115690 - 561 Protein_110 helix-turn-helix domain-containing protein -
N2A41_RS32235 (N2A41_32235) 115972..116265 - 294 WP_222384816.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N2A41_RS32240 (N2A41_32240) 116262..116504 - 243 WP_131664786.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
N2A41_RS32245 (N2A41_32245) 116671..117573 - 903 WP_260112153.1 MBL fold metallo-hydrolase -
N2A41_RS32250 (N2A41_32250) 117677..118309 - 633 WP_222384817.1 DsbA family protein -
N2A41_RS32255 (N2A41_32255) 118424..119317 + 894 WP_260112154.1 LysR family transcriptional regulator -
N2A41_RS32260 (N2A41_32260) 119484..119750 + 267 WP_222384819.1 acylphosphatase -
N2A41_RS32265 (N2A41_32265) 119904..120557 + 654 WP_260112155.1 Rieske (2Fe-2S) protein -
N2A41_RS32270 (N2A41_32270) 120554..121399 + 846 WP_222384821.1 aromatic ring-hydroxylating dioxygenase subunit alpha -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..326486 326486
- flank IS/Tn - - 114959..115690 731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin

Antitoxin ParD

(12-63)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11208.76 Da        Isoelectric Point: 5.5404

>T257076 WP_222384816.1 NZ_CP104039:c116265-115972 [Rhizobium leguminosarum bv. viciae]
MSFRLSAEAEEDIIAIAEQGVRLFGAGQAKRYHDELFALFDLIAANPRIARERDVIDPPVRIHPFKAHLIVYRIENDETI
FVIRIRHAHEDWATDSI

Download         Length: 294 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8841.99 Da        Isoelectric Point: 9.7320

>AT257076 WP_131664786.1 NZ_CP104039:c116504-116262 [Rhizobium leguminosarum bv. viciae]
MATMNVSLPGPMKDWVEAQAKTGRYSNASDYVRDLIRRDQTRNDKIAAMQSFVEAGLQSGVGVRSKDELFAEAMARTSKS

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References