Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 109885..110420 | Replicon | plasmid pSRDI969_2 |
| Accession | NZ_CP104037 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain SRDI969 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N2A41_RS27680 | Protein ID | WP_170256924.1 |
| Coordinates | 110130..110420 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | N2A41_RS27675 | Protein ID | WP_260111697.1 |
| Coordinates | 109885..110133 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2A41_RS27660 (N2A41_27660) | 105467..107176 | + | 1710 | WP_260111695.1 | ABC transporter ATP-binding protein | - |
| N2A41_RS27665 (N2A41_27665) | 107196..108710 | + | 1515 | WP_222386008.1 | ABC transporter substrate-binding protein | - |
| N2A41_RS27670 (N2A41_27670) | 108795..109670 | - | 876 | WP_260111696.1 | glutathione-dependent disulfide-bond oxidoreductase | - |
| N2A41_RS27675 (N2A41_27675) | 109885..110133 | + | 249 | WP_260111697.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| N2A41_RS27680 (N2A41_27680) | 110130..110420 | + | 291 | WP_170256924.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N2A41_RS27685 (N2A41_27685) | 110432..111283 | - | 852 | WP_260111698.1 | NAD(P)-dependent oxidoreductase | - |
| N2A41_RS27690 (N2A41_27690) | 111495..111962 | + | 468 | WP_260111699.1 | universal stress protein | - |
| N2A41_RS27695 (N2A41_27695) | 112080..112994 | + | 915 | WP_260111700.1 | J domain-containing protein | - |
| N2A41_RS27700 (N2A41_27700) | 112997..113320 | + | 324 | WP_260060111.1 | chaperone modulator CbpM | - |
| N2A41_RS27705 (N2A41_27705) | 113335..114264 | - | 930 | WP_260111701.1 | phosphatidate cytidylyltransferase | - |
| N2A41_RS27710 (N2A41_27710) | 114261..114881 | - | 621 | WP_017969181.1 | lysophospholipid acyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | gmd | 1..548849 | 548849 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11089.51 Da Isoelectric Point: 6.7147
>T257074 WP_170256924.1 NZ_CP104037:110130-110420 [Rhizobium leguminosarum bv. viciae]
MTDIIFSPAAQTDIDKIWDYTATSWNVDQAERYVQDIRDACQDLAEGTRMSRPSDIRKGYRKVSVGSHFLYFQSNDAGQI
IIVRILHQRMDVAKHL
MTDIIFSPAAQTDIDKIWDYTATSWNVDQAERYVQDIRDACQDLAEGTRMSRPSDIRKGYRKVSVGSHFLYFQSNDAGQI
IIVRILHQRMDVAKHL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|