Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 287360..288162 | Replicon | plasmid pSRDI969_1 |
| Accession | NZ_CP104036 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain SRDI969 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | - |
| Locus tag | N2A41_RS25530 | Protein ID | WP_222385899.1 |
| Coordinates | 287635..288162 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | - |
| Locus tag | N2A41_RS25525 | Protein ID | WP_164577378.1 |
| Coordinates | 287360..287638 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2A41_RS25505 (N2A41_25505) | 282591..284111 | - | 1521 | WP_170259487.1 | ABC transporter substrate-binding protein | - |
| N2A41_RS25510 (N2A41_25510) | 284325..285110 | + | 786 | WP_222385897.1 | IclR family transcriptional regulator | - |
| N2A41_RS25515 (N2A41_25515) | 285181..285903 | + | 723 | WP_017967670.1 | ribonuclease activity regulator RraA | - |
| N2A41_RS25520 (N2A41_25520) | 286330..287160 | + | 831 | WP_260111439.1 | DUF6030 family protein | - |
| N2A41_RS25525 (N2A41_25525) | 287360..287638 | + | 279 | WP_164577378.1 | DUF1778 domain-containing protein | Antitoxin |
| N2A41_RS25530 (N2A41_25530) | 287635..288162 | + | 528 | WP_222385899.1 | GNAT family N-acetyltransferase | Toxin |
| N2A41_RS25535 (N2A41_25535) | 289040..289561 | + | 522 | WP_026154513.1 | tetratricopeptide repeat protein | - |
| N2A41_RS25540 (N2A41_25540) | 289676..290236 | - | 561 | WP_260111408.1 | hypothetical protein | - |
| N2A41_RS25545 (N2A41_25545) | 290316..291620 | - | 1305 | WP_260111409.1 | AAA family ATPase | - |
| N2A41_RS25550 (N2A41_25550) | 291636..292580 | - | 945 | WP_260111410.1 | type II secretion system F family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..637289 | 637289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 18763.76 Da Isoelectric Point: 8.8575
>T257073 WP_222385899.1 NZ_CP104036:287635-288162 [Rhizobium leguminosarum bv. viciae]
VTLPVWHEEPIAKSHDRAAFDCGDAAMNEFIRRLARQSHEQNAAKTFCAIDKAQPDCILGFYTVAPSAVTHEAVPPKMTR
GLARHEVAGFKLARLATDIKVAGKGLGGQFIAAAALRCLRLASEGGGILLIIDTKNERAAHWYAGYGAEPLQGKPLTLVM
PLATFAADFKAKGLL
VTLPVWHEEPIAKSHDRAAFDCGDAAMNEFIRRLARQSHEQNAAKTFCAIDKAQPDCILGFYTVAPSAVTHEAVPPKMTR
GLARHEVAGFKLARLATDIKVAGKGLGGQFIAAAALRCLRLASEGGGILLIIDTKNERAAHWYAGYGAEPLQGKPLTLVM
PLATFAADFKAKGLL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|