Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 51235..51911 Replicon plasmid pSRDI969_1
Accession NZ_CP104036
Organism Rhizobium leguminosarum bv. viciae strain SRDI969

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N2A41_RS24425 Protein ID WP_017967319.1
Coordinates 51486..51911 (+) Length 142 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A7Y2R170
Locus tag N2A41_RS24420 Protein ID WP_017967320.1
Coordinates 51235..51489 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N2A41_RS24385 (N2A41_24385) 46404..46529 - 126 Protein_44 EF-hand domain-containing protein -
N2A41_RS24390 (N2A41_24390) 46691..47335 + 645 WP_017967326.1 TetR/AcrR family transcriptional regulator -
N2A41_RS24395 (N2A41_24395) 47372..47569 + 198 Protein_46 DUF1217 domain-containing protein -
N2A41_RS24400 (N2A41_24400) 48015..48854 + 840 WP_260111303.1 transporter substrate-binding domain-containing protein -
N2A41_RS24405 (N2A41_24405) 48971..49633 + 663 WP_260111304.1 amino acid ABC transporter permease -
N2A41_RS24410 (N2A41_24410) 49639..50298 + 660 WP_017967322.1 amino acid ABC transporter permease -
N2A41_RS24415 (N2A41_24415) 50310..51080 + 771 WP_017967321.1 amino acid ABC transporter ATP-binding protein -
N2A41_RS24420 (N2A41_24420) 51235..51489 + 255 WP_017967320.1 plasmid stabilization protein Antitoxin
N2A41_RS24425 (N2A41_24425) 51486..51911 + 426 WP_017967319.1 type II toxin-antitoxin system VapC family toxin Toxin
N2A41_RS24430 (N2A41_24430) 52105..52857 + 753 WP_157386376.1 GntR family transcriptional regulator -
N2A41_RS24435 (N2A41_24435) 52851..53636 + 786 WP_017967318.1 transporter substrate-binding domain-containing protein -
N2A41_RS24440 (N2A41_24440) 53718..54389 + 672 WP_017967317.1 amino acid ABC transporter permease -
N2A41_RS24445 (N2A41_24445) 54386..55045 + 660 WP_017967316.1 amino acid ABC transporter permease -
N2A41_RS24450 (N2A41_24450) 55023..55748 + 726 WP_260111305.1 amino acid ABC transporter ATP-binding protein -
N2A41_RS24455 (N2A41_24455) 55745..55903 - 159 WP_260111454.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..637289 637289


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-123)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 142 a.a.        Molecular weight: 15038.25 Da        Isoelectric Point: 4.5882

>T257072 WP_017967319.1 NZ_CP104036:51486-51911 [Rhizobium leguminosarum bv. viciae]
MIILDTNVVSEAMKPAPDETVKFWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARAAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA

Download         Length: 426 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9260.57 Da        Isoelectric Point: 9.0495

>AT257072 WP_017967320.1 NZ_CP104036:51235-51489 [Rhizobium leguminosarum bv. viciae]
MPAVTIRNLSEATHRALKVRAAHHGRSAEAEMREILEAAVRPETRLHLGSALAERSRRLGLTNEDLAVLDQARDALPAKP
LSFE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y2R170

References