Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 51235..51911 | Replicon | plasmid pSRDI969_1 |
| Accession | NZ_CP104036 | ||
| Organism | Rhizobium leguminosarum bv. viciae strain SRDI969 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N2A41_RS24425 | Protein ID | WP_017967319.1 |
| Coordinates | 51486..51911 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A7Y2R170 |
| Locus tag | N2A41_RS24420 | Protein ID | WP_017967320.1 |
| Coordinates | 51235..51489 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N2A41_RS24385 (N2A41_24385) | 46404..46529 | - | 126 | Protein_44 | EF-hand domain-containing protein | - |
| N2A41_RS24390 (N2A41_24390) | 46691..47335 | + | 645 | WP_017967326.1 | TetR/AcrR family transcriptional regulator | - |
| N2A41_RS24395 (N2A41_24395) | 47372..47569 | + | 198 | Protein_46 | DUF1217 domain-containing protein | - |
| N2A41_RS24400 (N2A41_24400) | 48015..48854 | + | 840 | WP_260111303.1 | transporter substrate-binding domain-containing protein | - |
| N2A41_RS24405 (N2A41_24405) | 48971..49633 | + | 663 | WP_260111304.1 | amino acid ABC transporter permease | - |
| N2A41_RS24410 (N2A41_24410) | 49639..50298 | + | 660 | WP_017967322.1 | amino acid ABC transporter permease | - |
| N2A41_RS24415 (N2A41_24415) | 50310..51080 | + | 771 | WP_017967321.1 | amino acid ABC transporter ATP-binding protein | - |
| N2A41_RS24420 (N2A41_24420) | 51235..51489 | + | 255 | WP_017967320.1 | plasmid stabilization protein | Antitoxin |
| N2A41_RS24425 (N2A41_24425) | 51486..51911 | + | 426 | WP_017967319.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N2A41_RS24430 (N2A41_24430) | 52105..52857 | + | 753 | WP_157386376.1 | GntR family transcriptional regulator | - |
| N2A41_RS24435 (N2A41_24435) | 52851..53636 | + | 786 | WP_017967318.1 | transporter substrate-binding domain-containing protein | - |
| N2A41_RS24440 (N2A41_24440) | 53718..54389 | + | 672 | WP_017967317.1 | amino acid ABC transporter permease | - |
| N2A41_RS24445 (N2A41_24445) | 54386..55045 | + | 660 | WP_017967316.1 | amino acid ABC transporter permease | - |
| N2A41_RS24450 (N2A41_24450) | 55023..55748 | + | 726 | WP_260111305.1 | amino acid ABC transporter ATP-binding protein | - |
| N2A41_RS24455 (N2A41_24455) | 55745..55903 | - | 159 | WP_260111454.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..637289 | 637289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15038.25 Da Isoelectric Point: 4.5882
>T257072 WP_017967319.1 NZ_CP104036:51486-51911 [Rhizobium leguminosarum bv. viciae]
MIILDTNVVSEAMKPAPDETVKFWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARAAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA
MIILDTNVVSEAMKPAPDETVKFWLDEQAAETLFLSSVTIAELMFGIGALPAGKRKERLSDALDGLMELFERRILAFDIT
AARRYADLAVKARAAGRGFPTPDGYIAAIAASKGFAVATRDTSAFDAAGVEVINPWAASTA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|