Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 171778..172421 Replicon plasmid pCTXM65_150040X0B1
Accession NZ_CP104031
Organism Klebsiella pneumoniae strain 150040X0B1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N1940_RS27960 Protein ID WP_001044770.1
Coordinates 171778..172194 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N1940_RS27965 Protein ID WP_001261282.1
Coordinates 172191..172421 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1940_RS27935 (166862) 166862..167221 + 360 WP_015493069.1 hypothetical protein -
N1940_RS27940 (167847) 167847..168221 + 375 WP_008324180.1 hypothetical protein -
N1940_RS27945 (168347) 168347..169051 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
N1940_RS27950 (169135) 169135..170157 - 1023 WP_000361404.1 helicase UvrD -
N1940_RS27955 (170142) 170142..171704 - 1563 WP_004206609.1 AAA family ATPase -
N1940_RS27960 (171778) 171778..172194 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N1940_RS27965 (172191) 172191..172421 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N1940_RS27970 (172378) 172378..172839 + 462 WP_014343465.1 hypothetical protein -
N1940_RS27975 (173000) 173000..173944 + 945 WP_011977810.1 hypothetical protein -
N1940_RS27980 (173981) 173981..174373 + 393 WP_011977811.1 hypothetical protein -
N1940_RS27985 (174431) 174431..174952 + 522 WP_013214008.1 hypothetical protein -
N1940_RS27990 (174998) 174998..175201 + 204 WP_011977813.1 hypothetical protein -
N1940_RS27995 (175231) 175231..176235 + 1005 WP_011977814.1 hypothetical protein -
N1940_RS28000 (176419) 176419..177198 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-65 - 1..178278 178278
- flank IS/Tn - - 168347..169051 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T257061 WP_001044770.1 NZ_CP104031:c172194-171778 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT257061 WP_001261282.1 NZ_CP104031:c172421-172191 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References