Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4179618..4180237 Replicon chromosome
Accession NZ_CP104030
Organism Klebsiella pneumoniae strain 150040X0B1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N1940_RS20750 Protein ID WP_002892050.1
Coordinates 4180019..4180237 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N1940_RS20745 Protein ID WP_002892066.1
Coordinates 4179618..4179992 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N1940_RS20735 (N1940_20735) 4174770..4175963 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N1940_RS20740 (N1940_20740) 4175986..4179132 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
N1940_RS20745 (N1940_20745) 4179618..4179992 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N1940_RS20750 (N1940_20750) 4180019..4180237 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N1940_RS20755 (N1940_20755) 4180396..4180962 + 567 WP_002892030.1 maltose O-acetyltransferase -
N1940_RS20760 (N1940_20760) 4180934..4181074 - 141 WP_004147370.1 hypothetical protein -
N1940_RS20765 (N1940_20765) 4181095..4181565 + 471 WP_002892026.1 YlaC family protein -
N1940_RS20770 (N1940_20770) 4181540..4182991 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N1940_RS20775 (N1940_20775) 4183092..4183790 + 699 WP_002892021.1 GNAT family protein -
N1940_RS20780 (N1940_20780) 4183787..4183927 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N1940_RS20785 (N1940_20785) 4183927..4184190 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T257050 WP_002892050.1 NZ_CP104030:4180019-4180237 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT257050 WP_002892066.1 NZ_CP104030:4179618-4179992 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References