Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3042883..3043549 | Replicon | chromosome |
| Accession | NZ_CP104025 | ||
| Organism | Erwinia amylovora strain Ea915 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A830ZTB8 |
| Locus tag | MTP51_RS13810 | Protein ID | WP_004161808.1 |
| Coordinates | 3042883..3043302 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | D4HWC2 |
| Locus tag | MTP51_RS13815 | Protein ID | WP_004155593.1 |
| Coordinates | 3043283..3043549 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTP51_RS13795 (MTP51_13795) | 3038875..3040554 | + | 1680 | WP_004155599.1 | type III effector | - |
| MTP51_RS13800 (MTP51_13800) | 3041064..3042017 | + | 954 | WP_004155597.1 | DMT family transporter | - |
| MTP51_RS13805 (MTP51_13805) | 3042247..3042765 | + | 519 | WP_004155596.1 | flavodoxin FldB | - |
| MTP51_RS13810 (MTP51_13810) | 3042883..3043302 | - | 420 | WP_004161808.1 | protein YgfX | Toxin |
| MTP51_RS13815 (MTP51_13815) | 3043283..3043549 | - | 267 | WP_004155593.1 | FAD assembly factor SdhE | Antitoxin |
| MTP51_RS13820 (MTP51_13820) | 3043775..3044761 | + | 987 | WP_004155590.1 | tRNA-modifying protein YgfZ | - |
| MTP51_RS13825 (MTP51_13825) | 3044762..3045421 | - | 660 | WP_004155588.1 | hemolysin III family protein | - |
| MTP51_RS13830 (MTP51_13830) | 3045634..3046242 | + | 609 | WP_004155587.1 | HD domain-containing protein | - |
| MTP51_RS13835 (MTP51_13835) | 3046347..3047076 | - | 730 | Protein_2658 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16366.46 Da Isoelectric Point: 11.9444
>T257039 WP_004161808.1 NZ_CP104025:c3043302-3042883 [Erwinia amylovora]
VVLWQCELRPSRLAQRFSLLLHGAVMLALLLPTWPASSGLVRMLLLVLVLLECIRSRRRIGRRQGDIALLEGHELRWRQR
EWCIISRPWLTGQAILLLLQDTHGQRERLWLFADGMEKRNWRQLRLQLLNSKVQGNGWC
VVLWQCELRPSRLAQRFSLLLHGAVMLALLLPTWPASSGLVRMLLLVLVLLECIRSRRRIGRRQGDIALLEGHELRWRQR
EWCIISRPWLTGQAILLLLQDTHGQRERLWLFADGMEKRNWRQLRLQLLNSKVQGNGWC
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A830ZTB8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A831A3F0 |