Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2684624..2685251 | Replicon | chromosome |
Accession | NZ_CP104025 | ||
Organism | Erwinia amylovora strain Ea915 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D2T444 |
Locus tag | MTP51_RS12130 | Protein ID | WP_004156337.1 |
Coordinates | 2685033..2685251 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | MTP51_RS12125 | Protein ID | WP_013035913.1 |
Coordinates | 2684624..2685013 (+) | Length | 130 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTP51_RS12105 (MTP51_12105) | 2679643..2682789 | + | 3147 | WP_004156353.1 | multidrug efflux RND transporter permease subunit AcrB | - |
MTP51_RS12110 (MTP51_12110) | 2682937..2683218 | + | 282 | WP_004156350.1 | type B 50S ribosomal protein L31 | - |
MTP51_RS12115 (MTP51_12115) | 2683206..2683352 | + | 147 | WP_004156349.1 | type B 50S ribosomal protein L36 | - |
MTP51_RS12120 (MTP51_12120) | 2684124..2684477 | + | 354 | WP_004156342.1 | hypothetical protein | - |
MTP51_RS12125 (MTP51_12125) | 2684624..2685013 | + | 390 | WP_013035913.1 | Hha toxicity modulator TomB | Antitoxin |
MTP51_RS12130 (MTP51_12130) | 2685033..2685251 | + | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
MTP51_RS12140 (MTP51_12140) | 2685551..2685868 | + | 318 | WP_168397246.1 | MGMT family protein | - |
MTP51_RS12145 (MTP51_12145) | 2685891..2686448 | - | 558 | WP_004156333.1 | YbaY family lipoprotein | - |
MTP51_RS12150 (MTP51_12150) | 2686673..2687533 | + | 861 | WP_004156324.1 | acyl-CoA thioesterase II | - |
MTP51_RS12155 (MTP51_12155) | 2687608..2688909 | - | 1302 | WP_004172214.1 | ammonium transporter AmtB | - |
MTP51_RS12160 (MTP51_12160) | 2688927..2689265 | - | 339 | WP_004156319.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T257038 WP_004156337.1 NZ_CP104025:2685033-2685251 [Erwinia amylovora]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 130 a.a. Molecular weight: 14965.70 Da Isoelectric Point: 4.7040
>AT257038 WP_013035913.1 NZ_CP104025:2684624-2685013 [Erwinia amylovora]
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDSDLISQIDEYL
DDTFMLFSNYGVNNLDLQRWQKSAKRLFNIFAKECVMSQIQSSHSFSSP
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDSDLISQIDEYL
DDTFMLFSNYGVNNLDLQRWQKSAKRLFNIFAKECVMSQIQSSHSFSSP
Download Length: 390 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|