Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3042888..3043554 | Replicon | chromosome |
Accession | NZ_CP104022 | ||
Organism | Erwinia amylovora strain Ea102 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A830ZTB8 |
Locus tag | MTP49_RS13790 | Protein ID | WP_004161808.1 |
Coordinates | 3042888..3043307 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D4HWC2 |
Locus tag | MTP49_RS13795 | Protein ID | WP_004155593.1 |
Coordinates | 3043288..3043554 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTP49_RS13775 (MTP49_13775) | 3038880..3040559 | + | 1680 | WP_004155599.1 | type III effector | - |
MTP49_RS13780 (MTP49_13780) | 3041069..3042022 | + | 954 | WP_004155597.1 | DMT family transporter | - |
MTP49_RS13785 (MTP49_13785) | 3042252..3042770 | + | 519 | WP_004155596.1 | flavodoxin FldB | - |
MTP49_RS13790 (MTP49_13790) | 3042888..3043307 | - | 420 | WP_004161808.1 | protein YgfX | Toxin |
MTP49_RS13795 (MTP49_13795) | 3043288..3043554 | - | 267 | WP_004155593.1 | FAD assembly factor SdhE | Antitoxin |
MTP49_RS13800 (MTP49_13800) | 3043780..3044766 | + | 987 | WP_004155590.1 | tRNA-modifying protein YgfZ | - |
MTP49_RS13805 (MTP49_13805) | 3044767..3045426 | - | 660 | WP_004155588.1 | hemolysin III family protein | - |
MTP49_RS13810 (MTP49_13810) | 3045639..3046247 | + | 609 | WP_004155587.1 | HD domain-containing protein | - |
MTP49_RS13815 (MTP49_13815) | 3046352..3047081 | - | 730 | Protein_2654 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16366.46 Da Isoelectric Point: 11.9444
>T257030 WP_004161808.1 NZ_CP104022:c3043307-3042888 [Erwinia amylovora]
VVLWQCELRPSRLAQRFSLLLHGAVMLALLLPTWPASSGLVRMLLLVLVLLECIRSRRRIGRRQGDIALLEGHELRWRQR
EWCIISRPWLTGQAILLLLQDTHGQRERLWLFADGMEKRNWRQLRLQLLNSKVQGNGWC
VVLWQCELRPSRLAQRFSLLLHGAVMLALLLPTWPASSGLVRMLLLVLVLLECIRSRRRIGRRQGDIALLEGHELRWRQR
EWCIISRPWLTGQAILLLLQDTHGQRERLWLFADGMEKRNWRQLRLQLLNSKVQGNGWC
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A830ZTB8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A831A3F0 |