Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1869639..1870251 Replicon chromosome
Accession NZ_CP104022
Organism Erwinia amylovora strain Ea102

Toxin (Protein)


Gene name hicA Uniprot ID D2TUP9
Locus tag MTP49_RS08300 Protein ID WP_012906750.1
Coordinates 1870072..1870251 (-) Length 60 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID D4I356
Locus tag MTP49_RS08295 Protein ID WP_004157632.1
Coordinates 1869639..1870049 (-) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MTP49_RS08265 (MTP49_08265) 1865297..1865887 - 591 WP_223386180.1 DapH/DapD/GlmU-related protein -
MTP49_RS08270 (MTP49_08270) 1866517..1866789 + 273 WP_004157637.1 hypothetical protein -
MTP49_RS08275 (MTP49_08275) 1866800..1866973 + 174 WP_013036045.1 hypothetical protein -
MTP49_RS08280 (MTP49_08280) 1867068..1867241 + 174 WP_004157636.1 hypothetical protein -
MTP49_RS08285 (MTP49_08285) 1867499..1867711 + 213 WP_004157635.1 hypothetical protein -
MTP49_RS08290 (MTP49_08290) 1868582..1869583 - 1002 WP_004157633.1 acyltransferase -
MTP49_RS08295 (MTP49_08295) 1869639..1870049 - 411 WP_004157632.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
MTP49_RS08300 (MTP49_08300) 1870072..1870251 - 180 WP_012906750.1 type II toxin-antitoxin system HicA family toxin Toxin
MTP49_RS08305 (MTP49_08305) 1870771..1871499 - 729 WP_004157629.1 two-component system response regulator RstA -
MTP49_RS08310 (MTP49_08310) 1871676..1872140 + 465 WP_004157626.1 hypothetical protein -
MTP49_RS08315 (MTP49_08315) 1872144..1873535 - 1392 WP_004157625.1 amino acid permease -
MTP49_RS08320 (MTP49_08320) 1873743..1874693 - 951 WP_004157624.1 DUF1471 family protein YdgH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1856873..1876413 19540


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 60 a.a.        Molecular weight: 6644.85 Da        Isoelectric Point: 10.9132

>T257027 WP_012906750.1 NZ_CP104022:c1870251-1870072 [Erwinia amylovora]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL

Download         Length: 180 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14829.76 Da        Isoelectric Point: 4.3623

>AT257027 WP_004157632.1 NZ_CP104022:c1870049-1869639 [Erwinia amylovora]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIDAHIELLVEDGEAVPEATSVENWLADPDYVGVVWALVD
VDVTRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6XDK4

Antitoxin

Source ID Structure
AlphaFold DB A0A830ZVY0

References