Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2800318..2800847 | Replicon | chromosome |
Accession | NZ_CP104020 | ||
Organism | Staphylococcus aureus strain 0831 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | N0J69_RS13980 | Protein ID | WP_000621175.1 |
Coordinates | 2800485..2800847 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | N0J69_RS13975 | Protein ID | WP_000948331.1 |
Coordinates | 2800318..2800488 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0J69_RS13945 (2795355) | 2795355..2795915 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
N0J69_RS13950 (2796123) | 2796123..2796602 | + | 480 | WP_001287088.1 | hypothetical protein | - |
N0J69_RS13955 (2796595) | 2796595..2798178 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
N0J69_RS13960 (2798165) | 2798165..2798656 | + | 492 | WP_001205910.1 | PH domain-containing protein | - |
N0J69_RS13965 (2798660) | 2798660..2799019 | + | 360 | WP_000581200.1 | holo-ACP synthase | - |
N0J69_RS13970 (2799085) | 2799085..2800233 | + | 1149 | WP_001281145.1 | alanine racemase | - |
N0J69_RS13975 (2800318) | 2800318..2800488 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N0J69_RS13980 (2800485) | 2800485..2800847 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
N0J69_RS13985 (2801197) | 2801197..2802198 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
N0J69_RS13990 (2802317) | 2802317..2802643 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
N0J69_RS13995 (2802645) | 2802645..2803124 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
N0J69_RS14000 (2803099) | 2803099..2803869 | + | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T257023 WP_000621175.1 NZ_CP104020:2800485-2800847 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|