Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1226194..1226671 Replicon chromosome
Accession NZ_CP104020
Organism Staphylococcus aureus strain 0831

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag N0J69_RS06235 Protein ID WP_000052078.1
Coordinates 1226483..1226671 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag N0J69_RS06230 Protein ID WP_001059690.1
Coordinates 1226194..1226454 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0J69_RS06195 (1221587) 1221587..1222303 - 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -
N0J69_RS06200 (1222451) 1222451..1222873 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
N0J69_RS06205 (1223272) 1223272..1223766 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
N0J69_RS06210 (1223921) 1223921..1224538 + 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
N0J69_RS06215 (1224611) 1224611..1225192 - 582 WP_001140686.1 histidine phosphatase family protein -
N0J69_RS06220 (1225417) 1225417..1225653 + 237 WP_000368687.1 hypothetical protein -
N0J69_RS06225 (1225650) 1225650..1225853 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
N0J69_RS06230 (1226194) 1226194..1226454 + 261 WP_001059690.1 hypothetical protein Antitoxin
N0J69_RS06235 (1226483) 1226483..1226671 + 189 WP_000052078.1 hypothetical protein Toxin
N0J69_RS06240 (1226859) 1226859..1227428 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
N0J69_RS06245 (1227516) 1227516..1227800 + 285 WP_001004395.1 hypothetical protein -
N0J69_RS06250 (1227862) 1227862..1228080 + 219 WP_000005886.1 hypothetical protein -
N0J69_RS06255 (1228576) 1228576..1228776 - 201 WP_001059082.1 cold-shock protein -
N0J69_RS06260 (1229133) 1229133..1229819 - 687 WP_001548082.1 thermonuclease family protein -
N0J69_RS06265 (1230160) 1230160..1230630 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - selq / selk / vWbp 1200905..1240343 39438


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T257015 WP_000052078.1 NZ_CP104020:1226483-1226671 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT257015 WP_001059690.1 NZ_CP104020:1226194-1226454 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References