Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3838726..3839383 | Replicon | chromosome |
| Accession | NZ_CP104014 | ||
| Organism | Enterobacter sp. CP102 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | N1249_RS18040 | Protein ID | WP_014071653.1 |
| Coordinates | 3838726..3839136 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A198H1V0 |
| Locus tag | N1249_RS18045 | Protein ID | WP_014071654.1 |
| Coordinates | 3839117..3839383 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1249_RS18020 (N1249_18020) | 3834720..3836453 | - | 1734 | WP_259831844.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N1249_RS18025 (N1249_18025) | 3836459..3837172 | - | 714 | WP_014071650.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N1249_RS18030 (N1249_18030) | 3837201..3838097 | - | 897 | WP_259831845.1 | site-specific tyrosine recombinase XerD | - |
| N1249_RS18035 (N1249_18035) | 3838199..3838720 | + | 522 | WP_259831846.1 | flavodoxin FldB | - |
| N1249_RS18040 (N1249_18040) | 3838726..3839136 | - | 411 | WP_014071653.1 | protein YgfX | Toxin |
| N1249_RS18045 (N1249_18045) | 3839117..3839383 | - | 267 | WP_014071654.1 | FAD assembly factor SdhE | Antitoxin |
| N1249_RS18050 (N1249_18050) | 3839677..3840657 | + | 981 | WP_259831847.1 | tRNA-modifying protein YgfZ | - |
| N1249_RS18055 (N1249_18055) | 3840725..3841384 | - | 660 | WP_014071656.1 | hemolysin III family protein | - |
| N1249_RS18060 (N1249_18060) | 3841550..3841861 | - | 312 | WP_182062341.1 | N(4)-acetylcytidine aminohydrolase | - |
| N1249_RS18065 (N1249_18065) | 3841914..3842645 | + | 732 | WP_014071659.1 | MurR/RpiR family transcriptional regulator | - |
| N1249_RS18070 (N1249_18070) | 3842762..3844195 | + | 1434 | WP_259831848.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16191.12 Da Isoelectric Point: 11.5436
>T257008 WP_014071653.1 NZ_CP104014:c3839136-3838726 [Enterobacter sp. CP102]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLMMDSRLRWQGK
EWEIIGTPWMLSSGMMLRLRKVGGGRRQHLWLAADSMDEVEWRDLRRMVLQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLMMDSRLRWQGK
EWEIIGTPWMLSSGMMLRLRKVGGGRRQHLWLAADSMDEVEWRDLRRMVLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|