Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1086346..1086967 | Replicon | chromosome |
Accession | NZ_CP104014 | ||
Organism | Enterobacter sp. CP102 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A198GT90 |
Locus tag | N1249_RS05090 | Protein ID | WP_014069157.1 |
Coordinates | 1086346..1086564 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | N1249_RS05095 | Protein ID | WP_008499288.1 |
Coordinates | 1086593..1086967 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1249_RS05060 (N1249_05060) | 1082356..1082616 | + | 261 | WP_014069152.1 | type B 50S ribosomal protein L31 | - |
N1249_RS05065 (N1249_05065) | 1082619..1082759 | + | 141 | WP_006818844.1 | type B 50S ribosomal protein L36 | - |
N1249_RS05070 (N1249_05070) | 1082756..1083466 | - | 711 | WP_259835026.1 | GNAT family protein | - |
N1249_RS05075 (N1249_05075) | 1083566..1085026 | + | 1461 | WP_259835028.1 | PLP-dependent aminotransferase family protein | - |
N1249_RS05080 (N1249_05080) | 1084998..1085465 | - | 468 | WP_259835030.1 | YlaC family protein | - |
N1249_RS05085 (N1249_05085) | 1085582..1086133 | - | 552 | WP_259835031.1 | maltose O-acetyltransferase | - |
N1249_RS05090 (N1249_05090) | 1086346..1086564 | - | 219 | WP_014069157.1 | HHA domain-containing protein | Toxin |
N1249_RS05095 (N1249_05095) | 1086593..1086967 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
N1249_RS05100 (N1249_05100) | 1087481..1090627 | - | 3147 | WP_259835033.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N1249_RS05105 (N1249_05105) | 1090650..1091843 | - | 1194 | WP_259835034.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8579.94 Da Isoelectric Point: 8.9008
>T257001 WP_014069157.1 NZ_CP104014:c1086564-1086346 [Enterobacter sp. CP102]
MSDKPLTKIDYLLRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKIDYLLRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT257001 WP_008499288.1 NZ_CP104014:c1086967-1086593 [Enterobacter sp. CP102]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A198GT90 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |