Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 151036..151640 | Replicon | chromosome |
Accession | NZ_CP104014 | ||
Organism | Enterobacter sp. CP102 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N1249_RS00730 | Protein ID | WP_259833781.1 |
Coordinates | 151036..151221 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N1249_RS00735 | Protein ID | WP_259833783.1 |
Coordinates | 151236..151640 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1249_RS00710 (N1249_00710) | 146104..147255 | + | 1152 | WP_259833774.1 | L-threonine dehydrogenase | - |
N1249_RS00715 (N1249_00715) | 147341..148879 | + | 1539 | WP_014068390.1 | aldehyde dehydrogenase AldB | - |
N1249_RS00720 (N1249_00720) | 148876..149838 | - | 963 | WP_259833777.1 | LysR family transcriptional regulator | - |
N1249_RS00725 (N1249_00725) | 149959..150699 | + | 741 | WP_259833779.1 | MipA/OmpV family protein | - |
N1249_RS00730 (N1249_00730) | 151036..151221 | + | 186 | WP_259833781.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N1249_RS00735 (N1249_00735) | 151236..151640 | + | 405 | WP_259833783.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N1249_RS00740 (N1249_00740) | 151684..153633 | - | 1950 | WP_259833785.1 | glycoside hydrolase family 127 protein | - |
N1249_RS00745 (N1249_00745) | 153644..155044 | - | 1401 | WP_259833787.1 | MFS transporter | - |
N1249_RS00750 (N1249_00750) | 155269..156093 | + | 825 | WP_259833789.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6901.15 Da Isoelectric Point: 11.2509
>T256999 WP_259833781.1 NZ_CP104014:151036-151221 [Enterobacter sp. CP102]
VKSADVITILVSHGWKCIRTKGSHHQFRHPVYKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITILVSHGWKCIRTKGSHHQFRHPVYKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14890.74 Da Isoelectric Point: 4.3841
>AT256999 WP_259833783.1 NZ_CP104014:151236-151640 [Enterobacter sp. CP102]
MFYPAYIHSDLNGSASGFFPDVPGCFFAGDSLDDAFQDARAALTAHFEALFESEEELPLPGNVEAHLEATPADFIGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDLNGSASGFFPDVPGCFFAGDSLDDAFQDARAALTAHFEALFESEEELPLPGNVEAHLEATPADFIGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|