Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 3152880..3153488 | Replicon | chromosome |
Accession | NZ_CP104011 | ||
Organism | Pseudomonas sp. GCEP-101 isolate Gut |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | N0B71_RS14440 | Protein ID | WP_259753256.1 |
Coordinates | 3153141..3153488 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | N0B71_RS14435 | Protein ID | WP_259753255.1 |
Coordinates | 3152880..3153131 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0B71_RS14410 | 3148103..3148741 | - | 639 | WP_259753250.1 | ferric reductase-like transmembrane domain-containing protein | - |
N0B71_RS14415 | 3148866..3150176 | - | 1311 | WP_259753251.1 | HAMP domain-containing sensor histidine kinase | - |
N0B71_RS14420 | 3150173..3150913 | - | 741 | WP_259753252.1 | response regulator | - |
N0B71_RS14425 | 3151140..3151412 | + | 273 | WP_259753253.1 | DUF2790 domain-containing protein | - |
N0B71_RS14430 | 3151506..3152726 | + | 1221 | WP_259753254.1 | cytochrome c biogenesis protein DipZ | - |
N0B71_RS14435 | 3152880..3153131 | + | 252 | WP_259753255.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N0B71_RS14440 | 3153141..3153488 | + | 348 | WP_259753256.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0B71_RS14445 | 3153493..3155340 | - | 1848 | WP_259753257.1 | sensor domain-containing diguanylate cyclase | - |
N0B71_RS14450 | 3155611..3156681 | - | 1071 | WP_259753258.1 | serine/threonine-protein kinase | - |
N0B71_RS14455 | 3156681..3157736 | - | 1056 | WP_259753259.1 | serine/threonine-protein kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13202.18 Da Isoelectric Point: 6.2124
>T256997 WP_259753256.1 NZ_CP104011:3153141-3153488 [Pseudomonas sp. GCEP-101]
VSRLVVRFTHTAEQSIQDQVHHLVPFLGQQNALDSLLELIVEIEEKLPRAPAGYPVSEQASLLGVLHFREFNTGPYRVFY
EVHEHLSEIAVILVLRQKQSVQQQLIRYCLVGPFE
VSRLVVRFTHTAEQSIQDQVHHLVPFLGQQNALDSLLELIVEIEEKLPRAPAGYPVSEQASLLGVLHFREFNTGPYRVFY
EVHEHLSEIAVILVLRQKQSVQQQLIRYCLVGPFE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|