Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3116898..3117584 | Replicon | chromosome |
Accession | NZ_CP104011 | ||
Organism | Pseudomonas sp. GCEP-101 isolate Gut |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | N0B71_RS14270 | Protein ID | WP_259753222.1 |
Coordinates | 3116898..3117311 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | N0B71_RS14275 | Protein ID | WP_259753223.1 |
Coordinates | 3117336..3117584 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0B71_RS14265 | 3114827..3116854 | + | 2028 | WP_259759463.1 | exodeoxyribonuclease V subunit alpha | - |
N0B71_RS14270 | 3116898..3117311 | - | 414 | WP_259753222.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N0B71_RS14275 | 3117336..3117584 | - | 249 | WP_259753223.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N0B71_RS14280 | 3117754..3120600 | + | 2847 | WP_259753224.1 | ATP-binding protein | - |
N0B71_RS14285 | 3120579..3121775 | + | 1197 | WP_259753225.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14917.07 Da Isoelectric Point: 5.6864
>T256996 WP_259753222.1 NZ_CP104011:c3117311-3116898 [Pseudomonas sp. GCEP-101]
MLDTNICSLIMRKNPPQVLQRLQHAAEAGNRLVISAITYAELRYGAASPKAPRAVTAWIDALVQRLDDVLPWDSDAVDAS
AKLMRQLLDAGTPIGPNDTGIAGHALATQCIVVTNNTREFRRVPGLLVEDWCSDQPT
MLDTNICSLIMRKNPPQVLQRLQHAAEAGNRLVISAITYAELRYGAASPKAPRAVTAWIDALVQRLDDVLPWDSDAVDAS
AKLMRQLLDAGTPIGPNDTGIAGHALATQCIVVTNNTREFRRVPGLLVEDWCSDQPT
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|