Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 1977921..1978440 | Replicon | chromosome |
Accession | NZ_CP104011 | ||
Organism | Pseudomonas sp. GCEP-101 isolate Gut |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | N0B71_RS08910 | Protein ID | WP_259758401.1 |
Coordinates | 1977921..1978205 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N0B71_RS08915 | Protein ID | WP_259758403.1 |
Coordinates | 1978195..1978440 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N0B71_RS08890 | 1973657..1973788 | + | 132 | WP_259758396.1 | hypothetical protein | - |
N0B71_RS08895 | 1973852..1974568 | - | 717 | WP_259758397.1 | carbonic anhydrase | - |
N0B71_RS08900 | 1974860..1975918 | - | 1059 | WP_259758399.1 | PA0069 family radical SAM protein | - |
N0B71_RS08905 | 1976106..1977728 | - | 1623 | WP_259758400.1 | inorganic phosphate transporter | - |
N0B71_RS08910 | 1977921..1978205 | - | 285 | WP_259758401.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N0B71_RS08915 | 1978195..1978440 | - | 246 | WP_259758403.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N0B71_RS08920 | 1978561..1978830 | - | 270 | WP_259758404.1 | YheV family putative zinc ribbon protein | - |
N0B71_RS08925 | 1978830..1980875 | - | 2046 | WP_259758405.1 | oligopeptidase A | - |
N0B71_RS08930 | 1980952..1981494 | + | 543 | WP_259758406.1 | gamma carbonic anhydrase family protein | - |
N0B71_RS08935 | 1981782..1982918 | + | 1137 | WP_259758407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11005.70 Da Isoelectric Point: 10.1538
>T256995 WP_259758401.1 NZ_CP104011:c1978205-1977921 [Pseudomonas sp. GCEP-101]
MTYELEFLPAALKEWRKLGHTVREQFKRKLAERLEEPRVPADALHGLADHYKIKLRSAGYRLVYRVEDERVVIAVVAVGK
RERGEVYSAAQDRR
MTYELEFLPAALKEWRKLGHTVREQFKRKLAERLEEPRVPADALHGLADHYKIKLRSAGYRLVYRVEDERVVIAVVAVGK
RERGEVYSAAQDRR
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|