Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 1950946..1951451 | Replicon | chromosome |
| Accession | NZ_CP104011 | ||
| Organism | Pseudomonas sp. GCEP-101 isolate Gut | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N0B71_RS08760 | Protein ID | WP_259758374.1 |
| Coordinates | 1950946..1951227 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | N0B71_RS08765 | Protein ID | WP_259758375.1 |
| Coordinates | 1951224..1951451 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0B71_RS08740 | 1946434..1947615 | - | 1182 | WP_259758371.1 | tricarballylate utilization 4Fe-4S protein TcuB | - |
| N0B71_RS08745 | 1947596..1949050 | - | 1455 | WP_259758372.1 | FAD-dependent tricarballylate dehydrogenase TcuA | - |
| N0B71_RS08750 | 1949183..1950118 | - | 936 | WP_259759510.1 | LysR substrate-binding domain-containing protein | - |
| N0B71_RS08755 | 1950424..1950711 | + | 288 | WP_259758373.1 | DUF2218 domain-containing protein | - |
| N0B71_RS08760 | 1950946..1951227 | - | 282 | WP_259758374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N0B71_RS08765 | 1951224..1951451 | - | 228 | WP_259758375.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| N0B71_RS08770 | 1951552..1952284 | + | 733 | Protein_1722 | phytanoyl-CoA dioxygenase family protein | - |
| N0B71_RS08775 | 1952310..1952711 | + | 402 | WP_259758376.1 | GFA family protein | - |
| N0B71_RS08780 | 1952833..1954791 | - | 1959 | WP_259758377.1 | DUF4105 domain-containing protein | - |
| N0B71_RS08785 | 1954788..1955123 | - | 336 | WP_259758379.1 | DUF2388 domain-containing protein | - |
| N0B71_RS08790 | 1955162..1955455 | - | 294 | WP_259758380.1 | DUF2388 domain-containing protein | - |
| N0B71_RS08795 | 1955567..1955887 | - | 321 | WP_081518914.1 | DUF2388 domain-containing protein | - |
| N0B71_RS08800 | 1955980..1956180 | - | 201 | WP_259758381.1 | DUF1127 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10453.93 Da Isoelectric Point: 6.4638
>T256994 WP_259758374.1 NZ_CP104011:c1951227-1950946 [Pseudomonas sp. GCEP-101]
MSLQWTHKAAADLDAIYDHYVVLIGPEKALRAIQDIVEQVRPLANLEQSSSGMPSEVPGVRELPVERWPYQAAFRVKGRS
VQILRIDRVDNSG
MSLQWTHKAAADLDAIYDHYVVLIGPEKALRAIQDIVEQVRPLANLEQSSSGMPSEVPGVRELPVERWPYQAAFRVKGRS
VQILRIDRVDNSG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|