Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 1950946..1951451 Replicon chromosome
Accession NZ_CP104011
Organism Pseudomonas sp. GCEP-101 isolate Gut

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag N0B71_RS08760 Protein ID WP_259758374.1
Coordinates 1950946..1951227 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag N0B71_RS08765 Protein ID WP_259758375.1
Coordinates 1951224..1951451 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0B71_RS08740 1946434..1947615 - 1182 WP_259758371.1 tricarballylate utilization 4Fe-4S protein TcuB -
N0B71_RS08745 1947596..1949050 - 1455 WP_259758372.1 FAD-dependent tricarballylate dehydrogenase TcuA -
N0B71_RS08750 1949183..1950118 - 936 WP_259759510.1 LysR substrate-binding domain-containing protein -
N0B71_RS08755 1950424..1950711 + 288 WP_259758373.1 DUF2218 domain-containing protein -
N0B71_RS08760 1950946..1951227 - 282 WP_259758374.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N0B71_RS08765 1951224..1951451 - 228 WP_259758375.1 CopG family ribbon-helix-helix protein Antitoxin
N0B71_RS08770 1951552..1952284 + 733 Protein_1722 phytanoyl-CoA dioxygenase family protein -
N0B71_RS08775 1952310..1952711 + 402 WP_259758376.1 GFA family protein -
N0B71_RS08780 1952833..1954791 - 1959 WP_259758377.1 DUF4105 domain-containing protein -
N0B71_RS08785 1954788..1955123 - 336 WP_259758379.1 DUF2388 domain-containing protein -
N0B71_RS08790 1955162..1955455 - 294 WP_259758380.1 DUF2388 domain-containing protein -
N0B71_RS08795 1955567..1955887 - 321 WP_081518914.1 DUF2388 domain-containing protein -
N0B71_RS08800 1955980..1956180 - 201 WP_259758381.1 DUF1127 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10453.93 Da        Isoelectric Point: 6.4638

>T256994 WP_259758374.1 NZ_CP104011:c1951227-1950946 [Pseudomonas sp. GCEP-101]
MSLQWTHKAAADLDAIYDHYVVLIGPEKALRAIQDIVEQVRPLANLEQSSSGMPSEVPGVRELPVERWPYQAAFRVKGRS
VQILRIDRVDNSG

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8271.27 Da        Isoelectric Point: 5.9478

>AT256994 WP_259758375.1 NZ_CP104011:c1951451-1951224 [Pseudomonas sp. GCEP-101]
VTTVVSFRADDALVAALDQLARATHRDRPYHLRQALAQYLERQSWHVAAIDEGVADADAGHLLEHAVIEAKWGLA

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References